1735810952 941960 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149205&oldid=149204 5* 03ZCX islptng 5* (+0) 10fix
< 1735811062 830287 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735811072 323469 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149206&oldid=149205 5* 03ZCX islptng 5* (+57) 10
> 1735811659 636594 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149207&oldid=149206 5* 03ZCX islptng 5* (+257) 10
> 1735811710 467574 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149208&oldid=149207 5* 03ZCX islptng 5* (+88) 10
< 1735812325 554227 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735812948 271934 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1735815254 985131 :zenmov!~zenmov@user/zenmov JOIN #esolangs zenmov :zenmov
> 1735816176 909312 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149209&oldid=149145 5* 03None1 5* (+325) 10/* */
< 1735816818 522700 :Lymia!lymia@ayame.servers.aura.moe QUIT :Ping timeout: 276 seconds
< 1735816856 447821 :Lymia!lymia@ayame.servers.aura.moe JOIN #esolangs Lymia :Lymia Aluysia
< 1735817345 588979 :shachaf!~shachaf@user/shachaf PRIVMSG #esolangs :This number format seems appropriate for this channe: https://adamscherlis.github.io/blog/iterlog-coding/
< 1735817362 219830 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735819072 37805 :int-e!~noone@int-e.eu PRIVMSG #esolangs :a floating point Levenshtein-like coding?
< 1735819436 481979 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735819544 618282 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735819747 76002 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735820066 69326 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735820783 768856 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149210&oldid=149178 5* 03Jan jelo 5* (+182) 10/* Examples */
> 1735821281 122797 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149211&oldid=149210 5* 03Jan jelo 5* (+185) 10/* Examples */
> 1735822131 97240 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149212&oldid=149211 5* 03Jan jelo 5* (+11) 10/* Examples */
> 1735822292 749708 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149213&oldid=146880 5* 03Jan jelo 5* (+191) 10/* Examples */
< 1735822902 424286 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1735823124 358979 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735823559 439070 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149214&oldid=149213 5* 0347 5* (+70) 10/* Python */
> 1735823753 618558 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149215&oldid=149214 5* 0347 5* (-1) 10/* Python */
< 1735824359 466487 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1735824374 271931 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1735824703 747739 :roper!~rpr@91.126.186.102 QUIT :Quit: volta
< 1735825682 584263 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`learn password The password of the month is not from a jedi.
< 1735825689 666057 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :Relearned 'password': password The password of the month is not from a jedi.
< 1735825941 278948 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :shachaf: yes that does seem appropriate here
> 1735826073 677529 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Calculus is fun 5* 10New user account
> 1735826566 301646 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149216&oldid=149183 5* 03Calculus is fun 5* (+186) 10
> 1735826605 673110 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Pycone10]] to [[Track!]]
> 1735826606 77950 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149219&oldid=149216 5* 03Calculus is fun 5* (+106) 10
> 1735826653 962557 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149220&oldid=149217 5* 0347 5* (-237) 10
< 1735827021 967866 :zenmov!~zenmov@user/zenmov QUIT :Ping timeout: 252 seconds
< 1735827100 612884 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735827129 991405 :zenmov!~zenmov@user/zenmov JOIN #esolangs zenmov :zenmov
< 1735829041 96768 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1735830019 779753 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1735831036 801851 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Calculus is fun 5* 10uploaded "[[02File:MoreMathLogo.png10]]"
< 1735831233 988128 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735832304 974886 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1735832466 829734 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1735835034 40659 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735837088 442559 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 N10 02https://esolangs.org/w/index.php?oldid=149222 5* 03Calculus is fun 5* (+3180) 10Intro, Logo, partially done with commands.
> 1735837911 556696 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149223&oldid=149222 5* 03Calculus is fun 5* (+482) 10Added Category tags at bottom
< 1735838647 53749 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735838973 981404 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735840273 950991 :^[!~user@user//x-8473491 QUIT :Ping timeout: 245 seconds
< 1735840386 541322 :^[!~user@user//x-8473491 JOIN #esolangs ^[ :user
> 1735842046 342063 PRIVMSG #esolangs :14[[07InfuckBra14]]4 N10 02https://esolangs.org/w/index.php?oldid=149224 5* 03Tommyaweosme 5* (+484) 10Created page with "{{lowercase}}infuckBra is [[brainfuck]] but its on a torus, so at the end, the code will go back to the start again with the same cell confirgurations == extra commands == % - skip next command if this is not first time through == conceptualizing == the script "+
< 1735842563 145026 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1735842565 148393 :zenmov!~zenmov@user/zenmov QUIT :Ping timeout: 252 seconds
< 1735842643 919291 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 264 seconds
< 1735842644 976365 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1735842875 809474 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735843230 964261 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149225 5* 03Jan jelo 5* (+1610) 10Created page with "This python program compiles minsky machine program into Muriel program.(Using state 0 means halt, and the program starts from state 1.) program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' def r(s): return (s.replace("\\","\\\
> 1735843511 106874 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149226&oldid=149225 5* 03Jan jelo 5* (+1137) 10
> 1735843574 276430 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149227&oldid=149226 5* 03Jan jelo 5* (+0) 10
> 1735843863 939417 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149228&oldid=149212 5* 03Jan jelo 5* (+140) 10/* Computational class */
> 1735843889 991224 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149229&oldid=149227 5* 03Jan jelo 5* (+0) 10
> 1735844203 90562 PRIVMSG #esolangs :14[[07Deadman14]]4 N10 02https://esolangs.org/w/index.php?oldid=149230 5* 03Win7HE 5* (+1128) 10Created page with "'''Deadman''' is created by [[Win7HE]], that contains new stuff like , , , and input, and is a joke language. == Commands == is i, is d, is s, is o, multiplies by 2, changes the code pointer position to the accumulator, sets the accumulator to nothing, sets the
> 1735844229 775816 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149231&oldid=149230 5* 03Win7HE 5* (+5) 10
> 1735844252 941502 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149232&oldid=149229 5* 03Jan jelo 5* (+21) 10
> 1735844309 19829 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149233&oldid=149231 5* 03Win7HE 5* (+9) 10
> 1735844332 790145 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149234&oldid=149233 5* 03Win7HE 5* (+2) 10/* Hello world program */
> 1735844363 132877 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149235&oldid=149234 5* 03Win7HE 5* (+13) 10/* (without looping with jumps) Truth Machine */
> 1735844421 966926 PRIVMSG #esolangs :14[[07Deadfish14]]4 10 02https://esolangs.org/w/index.php?diff=149236&oldid=148298 5* 03Win7HE 5* (+121) 10
> 1735844433 374431 PRIVMSG #esolangs :14[[07Talk:Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149237&oldid=116445 5* 03Jan jelo 5* (+232) 10
> 1735844473 361184 PRIVMSG #esolangs :14[[07Deadfish14]]4 10 02https://esolangs.org/w/index.php?diff=149238&oldid=149236 5* 03Win7HE 5* (+51) 10/* Variants of deadfish */
< 1735844848 191318 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735845955 577666 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149239&oldid=149223 5* 03Calculus is fun 5* (+1373) 10Finished command list
< 1735846446 158932 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735846555 335040 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735846771 928159 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735846861 107254 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149240&oldid=149239 5* 03Calculus is fun 5* (+362) 10/* Creating conditions */
> 1735847140 481513 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149241&oldid=149240 5* 03Calculus is fun 5* (+22) 10/* Creating conditions */
> 1735847210 723590 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149242&oldid=149241 5* 03Calculus is fun 5* (+56) 10/* Standard operations */
< 1735847564 844280 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735848125 233145 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149243&oldid=149242 5* 03Calculus is fun 5* (+512) 10Added examples
< 1735848134 750730 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735848284 563159 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1735850799 374939 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=149244&oldid=78537 5* 03Jan jelo 5* (+200) 10/* Programming quirk? */
< 1735851343 953689 :roper!~rpr@91.126.186.102 QUIT :Quit: zzz
< 1735853300 114785 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735853769 943234 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149245&oldid=149243 5* 0347 5* (-20) 10/* Implementations */
> 1735853858 257859 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149246&oldid=149245 5* 0347 5* (-239) 10/* Implementations */
> 1735853948 412592 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149247&oldid=149246 5* 0347 5* (-33) 10/* Implementations */
> 1735853973 980254 PRIVMSG #esolangs :14[[07Brain14]]4 10 02https://esolangs.org/w/index.php?diff=149248&oldid=127206 5* 0347 5* (-19) 10/* Categories */
> 1735854002 246257 PRIVMSG #esolangs :14[[07F'juhv iK'tlhUng14]]4 10 02https://esolangs.org/w/index.php?diff=149249&oldid=141956 5* 0347 5* (-19) 10/* Categories */
> 1735854031 424128 PRIVMSG #esolangs :14[[07Scrambled14]]4 10 02https://esolangs.org/w/index.php?diff=149250&oldid=127137 5* 0347 5* (-19) 10/* Categories */
> 1735854050 557523 PRIVMSG #esolangs :14[[07TlhIngan14]]4 10 02https://esolangs.org/w/index.php?diff=149251&oldid=124792 5* 0347 5* (-19) 10/* Valid identifier */
> 1735854051 420269 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149252&oldid=133750 5* 03.k 5* (+117) 10
> 1735854063 887498 PRIVMSG #esolangs :14[[07TREE(3)14]]4 10 02https://esolangs.org/w/index.php?diff=149253&oldid=126294 5* 0347 5* (-19) 10/* Categories */
> 1735854109 523006 PRIVMSG #esolangs :14[[07Esme14]]4 10 02https://esolangs.org/w/index.php?diff=149254&oldid=94111 5* 0347 5* (-22) 10/* Implementations */
> 1735854122 832646 PRIVMSG #esolangs :14[[07FURscript14]]4 10 02https://esolangs.org/w/index.php?diff=149255&oldid=99217 5* 0347 5* (-22) 10/* Compilers */
> 1735854139 468944 PRIVMSG #esolangs :14[[07Snack14]]4 10 02https://esolangs.org/w/index.php?diff=149256&oldid=102375 5* 0347 5* (-22) 10/* Another simple interpreter */
> 1735854278 79534 PRIVMSG #esolangs :14[[07BittyLang14]]4 10 02https://esolangs.org/w/index.php?diff=149257&oldid=143746 5* 0347 5* (-1) 10/* Interpreter in Python */
> 1735857528 520544 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149258&oldid=149252 5* 03.k 5* (+41) 10
> 1735857597 538919 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149259&oldid=149258 5* 03.k 5* (-41) 10Undo revision [[Special:Diff/149258|149258]] by [[Special:Contributions/.k|.k]] ([[User talk:.k|talk]])
< 1735857994 219619 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1735858040 316049 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735858206 123100 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735858713 573114 PRIVMSG #esolangs :14[[07Kiwiscript14]]4 10 02https://esolangs.org/w/index.php?diff=149260&oldid=135542 5* 03Dmiz 5* (+146) 10
> 1735858748 88620 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149261&oldid=149194 5* 03Dmiz 5* (+147) 10
< 1735858749 792858 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735858956 324908 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149262&oldid=149114 5* 03Dmiz 5* (+14) 10numeric
> 1735859514 395817 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149263&oldid=129117 5* 03Dmiz 5* (+13) 10
> 1735859560 53157 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149264&oldid=149263 5* 03Dmiz 5* (-13) 10
< 1735859654 891764 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735859721 891500 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149265&oldid=149264 5* 03Dmiz 5* (+31) 10
> 1735859754 308469 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149266&oldid=149265 5* 03Dmiz 5* (+23) 10
> 1735859763 245343 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149267&oldid=149266 5* 03Dmiz 5* (-54) 10
< 1735859865 858402 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
> 1735859868 858149 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149268&oldid=149261 5* 03Dmiz 5* (+14) 10
< 1735859880 99843 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1735859884 923358 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149269&oldid=149268 5* 03Dmiz 5* (-14) 10
> 1735859911 235890 PRIVMSG #esolangs :14[[07Talk:Numeric14]]4 N10 02https://esolangs.org/w/index.php?oldid=149270 5* 03Dmiz 5* (+17) 10Created page with "[[Category:2025]]"
> 1735859940 180796 PRIVMSG #esolangs :14[[07Talk:Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149271&oldid=149270 5* 03Dmiz 5* (-17) 10Blanked the page
> 1735859964 450471 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149272&oldid=149269 5* 03Dmiz 5* (+15) 10
> 1735859984 682464 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149273&oldid=149272 5* 03Dmiz 5* (+4) 10
< 1735860040 746497 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1735860622 788218 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735862554 490579 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1735862735 477241 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1735863012 599960 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149274&oldid=145213 5* 03Kloodi 5* (-2) 10/* Truth Machine */
< 1735863868 34582 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
> 1735865067 690129 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149275&oldid=149262 5* 03Calculus is fun 5* (+18) 10Added MoreMathRPN
> 1735865847 223015 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149276&oldid=149247 5* 03Calculus is fun 5* (+335) 10Added matrix example
< 1735868077 178317 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Ping timeout: 252 seconds
< 1735868352 341060 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1735869260 415552 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149277&oldid=149276 5* 03Calculus is fun 5* (+648) 10Fractran example
< 1735869608 877984 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1735869840 678635 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149278&oldid=149277 5* 03Calculus is fun 5* (+0) 10/* Fibonnaci */
> 1735869897 621262 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149279&oldid=149278 5* 03Calculus is fun 5* (+0) 10/* Fractran interpreter */
< 1735870726 825727 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :
> 1735872030 81474 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149280&oldid=149279 5* 03Calculus is fun 5* (+7) 10replaced ascii arrows with unicode arrows
> 1735877053 828932 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149281&oldid=149208 5* 03ZCX islptng 5* (+2) 10
< 1735892159 971587 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735892889 22709 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735893260 389465 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149282&oldid=149235 5* 03Win7HE 5* (+95) 10
> 1735893533 985071 PRIVMSG #esolangs :14[[07Kiwiscript14]]4 10 02https://esolangs.org/w/index.php?diff=149283&oldid=149260 5* 03Ractangle 5* (-1) 10
> 1735893610 119502 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149284&oldid=148721 5* 03Win7HE 5* (+210) 10
> 1735893868 662609 PRIVMSG #esolangs :14[[07Talk:Deadman14]]4 N10 02https://esolangs.org/w/index.php?oldid=149285 5* 03Win7HE 5* (+20) 10Created page with "hi - [[User:Win7HE]]"
> 1735893911 721250 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149286&oldid=149284 5* 03Win7HE 5* (+31) 10/* Deadman (technically deadfish 2.1) */
> 1735893959 2253 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149287&oldid=149282 5* 03Win7HE 5* (+36) 10
> 1735894016 893598 PRIVMSG #esolangs :14[[07Talk:Deadfish/Constants14]]4 N10 02https://esolangs.org/w/index.php?oldid=149288 5* 03Win7HE 5* (+23) 10Created page with "hello - [[User:Win7HE]]"
> 1735894398 601499 PRIVMSG #esolangs :14[[07Talk:Deadfish with gotos and input14]]4 10 02https://esolangs.org/w/index.php?diff=149289&oldid=148254 5* 03Win7HE 5* (-98) 10
> 1735894419 362893 PRIVMSG #esolangs :14[[07Talk:Deadfish with gotos and input14]]4 10 02https://esolangs.org/w/index.php?diff=149290&oldid=149289 5* 03Win7HE 5* (+18) 10
> 1735894570 386519 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149291&oldid=149287 5* 03Win7HE 5* (+53) 10/* Example Programs */
> 1735894642 978095 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149292&oldid=149291 5* 03Win7HE 5* (+54) 10
> 1735895640 613527 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149293&oldid=149292 5* 03Win7HE 5* (-1) 10/* (without looping with jumps) Truth Machine */
> 1735899902 607713 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149294&oldid=149293 5* 03Win7HE 5* (+34) 10
> 1735900341 390997 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149295&oldid=147638 5* 03Win7HE 5* (+23) 10
> 1735900365 845468 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149296&oldid=149295 5* 03Win7HE 5* (+5) 10
> 1735900397 53175 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149297&oldid=149296 5* 03Win7HE 5* (-4) 10
< 1735901466 428860 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735905830 478733 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735905925 176115 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1735908109 868440 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1735908698 378434 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149298&oldid=149151 5* 03PrySigneToFry 5* (+82) 10
> 1735908949 439602 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149299&oldid=148899 5* 03PrySigneToFry 5* (+123) 10
> 1735909471 30951 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149300&oldid=149299 5* 03PrySigneToFry 5* (+448) 10
> 1735909512 841344 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149301 5* 03Jan jelo 5* (+2452) 10Created page with "This python program compiles Minsky machine program into program.(Using state 0 means halt,and the program starts from state 1.) program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' s=lambda x,y:f'/{x}\\/{y}\\' g=lambda x:f'/{x}\\' loop
> 1735909775 62963 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149302&oldid=149274 5* 03Kloodi 5* (+17) 10
> 1735909780 28682 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149303&oldid=149302 5* 03Jan jelo 5* (+176) 10
> 1735911628 908494 PRIVMSG #esolangs :14[[07Esy14]]4 N10 02https://esolangs.org/w/index.php?oldid=149304 5* 03Win7HE 5* (+7) 10Created page with "[[Eso]]"
> 1735911655 871881 PRIVMSG #esolangs :14[[07Esy14]]4 10 02https://esolangs.org/w/index.php?diff=149305&oldid=149304 5* 03Win7HE 5* (+5) 10
> 1735911691 732934 PRIVMSG #esolangs :14[[07Esy14]]4 10 02https://esolangs.org/w/index.php?diff=149306&oldid=149305 5* 03Win7HE 5* (+5) 10Redirected page to [[Eso]]
> 1735911949 693422 PRIVMSG #esolangs :14[[07User:ZCX islptng/My rate to the user I know14]]4 10 02https://esolangs.org/w/index.php?diff=149307&oldid=148683 5* 03ZCX islptng 5* (+32) 10
< 1735912164 92321 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1735912711 330466 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :so today, I did an OS upgrade but it went wrong, and while recovering I had to configure a network interface manually
< 1735912745 292656 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :ifconfig to bring it up, dhcpcd to get an IP address, but when trying to set up DNS, things went wrong in a somewhat eso way
< 1735912783 384478 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I was trying to use systemd's resolvectl to set a DNS server, but when I ran resolvectl, the setting generally only lasted a second or so, sometimes less
< 1735912793 722396 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and would go back to having no DNS server almost immediately
< 1735912828 5184 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :eventually I fixed it by writing a small script that ran resolvectl every 0.1 seconds in a loop, which held the DNS settings stable for long enough to actually download the packages I needed to complete the update
< 1735912867 815683 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmmm. So would dhcp give you wrong DNS servers or is there a third mechanism involved somewhere?
< 1735912886 315877 :int-e!~noone@int-e.eu PRIVMSG #esolangs :But yeah, that sounds like a fun workaround.
< 1735912908 824632 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :there were no DNS servers being given at all
< 1735912951 504206 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(also this is the first time I've used wired Internet in probably over a decade – trying to figure out how to do it wirelessly would have been even harder)
< 1735912982 215469 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I made a fresh system image for my raspberry over New Year's so there was some network configuration in that too. Nothing adverserial though unless you count the fact that as far as I can see, isc-dhcpd is no longer there, and udhcpd has its own set of quirks.
< 1735913010 878867 :int-e!~noone@int-e.eu PRIVMSG #esolangs :s/serial/sarial/
< 1735913061 483607 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1735913095 779089 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ouch
< 1735913118 937899 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I don't understand how network configuration with dhcp works at all on linux these days
< 1735913140 376992 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :it all seems opaque magic
< 1735913158 590014 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :well whatever opaque magic normally does it wasn't installed at the time
< 1735913187 689843 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :AFAICT, apt got a fraction of the way through the upgrade and then gave up, but most of what it did in the fraction that it completed was uninstalling things
< 1735913239 707154 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I expected udhcpd to default to class-based routing so 192.168.0.1 would come with a /24 netmask... well it gave out a 255.0.0.0 instead. Which happens to work for this setup but I still fixed it. ;-)
< 1735913262 414257 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :as long as you don't need to access any other addresses in 192/8 :-)
< 1735913275 780151 :int-e!~noone@int-e.eu PRIVMSG #esolangs :exactly
< 1735913281 363829 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(what even is there, is it just regular addresses outside 192.168/16?)
< 1735913322 879458 :int-e!~noone@int-e.eu PRIVMSG #esolangs :it would probably even work for that... because raspberry (= router) side the netmasks were correct and 192.168.0.1 is my default gateway.
< 1735913391 788094 :int-e!~noone@int-e.eu PRIVMSG #esolangs :ah
< 1735913440 608850 :int-e!~noone@int-e.eu PRIVMSG #esolangs :It would try to send directly instead of via 192.168.0.1. Still the same link though, and the router would see the packet. So it's murky territory.
< 1735913498 262372 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :this is the second time recently that I heard of an interrupted OS upgrade going bad
< 1735913501 848340 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I still think it would work because of the same link thing.
< 1735913580 289177 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(But would break the moment I'd add a switch.)
< 1735913641 531443 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: it's happened before to me but never quite this badly
< 1735913658 236990 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think last time I still had working networking so I was able to recover before rebooting
< 1735913665 608273 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh, no. The computer *should* try ARP to find the MAC address and that would fail, right?
< 1735913819 362144 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :in such a case, can you boot from a standalone installer disk and use that to access the package database of the existing system and update the OS that way, without depending on most of what's installed in it?
< 1735913865 832053 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: that was my plan B
< 1735913901 50263 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but it would take a while to find a standalone installer, I think I have an old one *somewhere* around here but it would take ages to find, and it is hard to make a new one without networking
< 1735914036 791606 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I see
< 1735914054 221983 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I do have one of those disks around, though I should probably burn a more recent one
< 1735914099 323491 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :you can use USB sticks rather than CDs
< 1735914105 460130 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I have to do it like that because my laptop doesn't have a CD drive
< 1735914129 330790 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :CDs will give you compatibility to older computers but that usually isn't important unless you're trying to give new life to a computer that's otherwise obsolete
< 1735914130 884027 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :also if I have a bootloader intact and the filesystem isn't horribly corrupted and I have internet (three big ifs) then I can boot the netboot installer from hard disk (I've done that before) since that is bootable as only a kernel and a small initrd, two files
< 1735914153 928699 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :and I have done the same with a bootloader from a CD but the two files on hard disk too
< 1735914170 454601 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I had intact bootloader, non-corrupted root filesystem but the others weren't mounting, and most of the networking-related packages weren't installed
< 1735914215 206184 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(I fixed the non-mounting filesystems problem by installing udev, which fortunately was in the package cache at the time – the installer pre-loads the package cache with packages it thinks it will need, it made a good decision with that one)
< 1735914602 995441 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmm, which distribution is that?
< 1735914723 592193 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Ubuntu
< 1735914983 36740 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Okay. So /maybe/ Debian is fine :)
< 1735915191 603954 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :the reason why it gave up was also strange, something went wrong configuring emacs
< 1735915209 517626 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :emacs is unlikely to be essential to the upgrade, so you'd expect the installer to just temporarily deconfigure it during the upgrade
< 1735915218 745153 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :or, well, treat it as half-deconfigured
< 1735915257 571861 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :that's what a purely apt+dpkg-based upgrade would do, but apparently Ubuntu was doing something different
< 1735915300 952535 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :yeah, emacs shouldn't be load-bearing during an upgrade
< 1735915448 722781 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :apt in general was struggling with the half-configured state, I ended up manually uninstalling emacs and everything that depends on it with dpkg
< 1735915457 571903 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :to remove the inconsistency
< 1735915462 252236 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(I reinstalled it afterwards)
< 1735915840 56407 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :Quit: bye bye
< 1735915886 168752 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1735916066 788530 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1735916138 764005 PRIVMSG #esolangs :14[[07User:Tommyaweosme/sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149308&oldid=131101 5* 03Tommyaweosme 5* (+47) 10
< 1735917370 492814 :fowl!~fowl@user/fowl QUIT :Read error: Connection reset by peer
< 1735917408 64364 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
> 1735918598 686607 PRIVMSG #esolangs :14[[07Talk:Python But WORST!!14]]4 N10 02https://esolangs.org/w/index.php?oldid=149309 5* 03Tommyaweosme 5* (+345) 10Created page with "little-known fact: chromeos exists, what does it do on my computer? ~~~~"
< 1735919824 858737 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735921671 619201 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149310&oldid=149298 5* 0347 5* (+56) 10/* Example */
> 1735921785 731356 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149311&oldid=149310 5* 0347 5* (-9) 10/* Example */
> 1735921802 829281 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149312&oldid=149311 5* 0347 5* (+1) 10/* Example */
< 1735921945 531020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735922146 982825 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149313&oldid=148840 5* 0347 5* (+81) 10/* Hello, world! */
> 1735922155 801348 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149314&oldid=149313 5* 0347 5* (+2) 10/* Implementations */
< 1735923943 596918 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735923959 921828 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1735924099 930696 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735924460 487174 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735925384 605669 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735928847 843260 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735929043 496786 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1735929077 121182 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1735929219 779411 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1735931094 532802 PRIVMSG #esolangs :14[[07Underload/a interpreter in Uiua14]]4 N10 02https://esolangs.org/w/index.php?oldid=149315 5* 03Jan jelo 5* (+986) 10Created page with "This is a [[Underload]] interpreter in Uiua written by [[User:Jan jelo]] C ::{} State C0{"aa""b""c"} I 0 S 1 P 2 # * (Join) J C I::2:0:1..S.:1P. # a (A) A C I::1:$"(_)"0.S.:1P. # ~ (Flip) F C I:{}1:0.:2.S.:1P. # : (D
> 1735931164 945437 PRIVMSG #esolangs :14[[07Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149316&oldid=149150 5* 03Jan jelo 5* (+58) 10/* External resources */
> 1735931251 498916 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149317&oldid=149180 5* 03Jan jelo 5* (+37) 10/* Intepreters */
> 1735931555 134861 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Uiua14]]4 N10 02https://esolangs.org/w/index.php?oldid=149318 5* 03Jan jelo 5* (+1471) 10Created page with "This is a [[Brainfuck]] interpreter in Uiua written by [[User:Jan jelo]]. P ( 0@+ | 1@- | 2@< | 3@> | 4@[ | 5@] | 6@. | 7@, | 8 ) Init { "\0" "\0" 0 } Lt 0 Rt 1 Pc 2 Pg 3 Op :Pg:Pc. Cur Lt Th (P
< 1735931820 589589 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1735931914 562266 PRIVMSG #esolangs :14[[07Underload/a interpreter in python14]]4 10 02https://esolangs.org/w/index.php?diff=149319&oldid=149133 5* 03Jan jelo 5* (+22) 10
< 1735931915 101627 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
> 1735932022 536765 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149320&oldid=149317 5* 03Jan jelo 5* (+44) 10/* Intepreters */
> 1735932244 433646 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149321&oldid=149104 5* 03Jan jelo 5* (+63) 10/* Python interpreters */
< 1735932258 230302 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735932306 789789 PRIVMSG #esolangs :14[[07Brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=149322&oldid=149321 5* 03Jan jelo 5* (+1) 10/* Python interpreters */
> 1735932547 98560 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149323&oldid=149322 5* 03Jan jelo 5* (+41) 10/* Python interpreters */
> 1735933528 564822 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 N10 02https://esolangs.org/w/index.php?oldid=149324 5* 03Jan jelo 5* (+2386) 10Created page with "This is a [[Brainfuck]] interpreter in Haskell written by [[User:Jan jelo]]. import Data.Char (chr,ord) main = run (filter(\x->any(==x)"+-<>.,[]")pgrm) 0 (Tape(Stack[])(Stack[])) 0 0 pgrm="++++++++++[>+++++++>+++
> 1735933579 21102 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149325&oldid=149320 5* 03Jan jelo 5* (+47) 10/* Intepreters */
> 1735933829 249959 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149326&oldid=149323 5* 03Jan jelo 5* (+77) 10/* Haskell interpreters */
< 1735934153 658780 :roper!~rpr@91.126.186.102 QUIT :Quit: prezzz
> 1735934444 781941 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149327&oldid=149324 5* 03Jan jelo 5* (+44) 10
> 1735934551 572355 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=149328&oldid=149087 5* 03Corbin 5* (+37) 10I suppose that it's only obvious that this is easy mode...
> 1735934590 998959 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149329&oldid=149327 5* 03Jan jelo 5* (-49) 10
> 1735934922 531275 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 N10 02https://esolangs.org/w/index.php?oldid=149330 5* 03Corbin 5* (+2030) 10...if there's also a hard mode available.
> 1735934995 143939 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149331&oldid=148835 5* 0347 5* (+0) 10/* Stuff to continue */
> 1735935703 25613 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149332&oldid=149326 5* 03Jan jelo 5* (-78) 10/* Notable implementations */
> 1735935939 892744 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=149333&oldid=145135 5* 03Jan jelo 5* (+141) 10/* Normal implementations */
> 1735935987 22110 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149334&oldid=149314 5* 03Ractangle 5* (-10) 10/* Syntax */
> 1735936042 448115 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=149335&oldid=149333 5* 03Jan jelo 5* (+0) 10/* Normal implementations */
> 1735936098 371366 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149336&oldid=149334 5* 03Ractangle 5* (+66) 10/* Implementations */
> 1735936133 864968 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149337&oldid=148839 5* 03Ractangle 5* (-1) 10/* Esolangs */
> 1735937612 403005 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149338&oldid=148170 5* 03Ractangle 5* (-16) 10/* Truth-machine */
> 1735937662 413486 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149339&oldid=149338 5* 03Ractangle 5* (+12) 10/* Truth-machine */
> 1735937714 219047 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149340&oldid=149339 5* 03Ractangle 5* (+0) 101*
> 1735937797 701231 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149341&oldid=149340 5* 03Ractangle 5* (-7) 10/* Truth-machine */
> 1735938126 380350 PRIVMSG #esolangs :14[[07User:Aadenboy/Template:Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149342 5* 03Aadenboy 5* (+134) 10Created page with "{{#{{{1|}}}:{{{2|}}}|{{{3|}}}|{{{4|}}}|{{{5|}}}}}{{User:Aadenboy/Template:Sandbox|ifeq|a|b|c|d}}"
> 1735938131 626281 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149343&oldid=149220 5* 03Ractangle 5* (+20) 10
> 1735938147 948768 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149344&oldid=149343 5* 03Ractangle 5* (+0) 10
> 1735938211 497078 PRIVMSG #esolangs :14[[072025!14]]4 10 02https://esolangs.org/w/index.php?diff=149345&oldid=149135 5* 03Ractangle 5* (+2) 10
< 1735938323 713019 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1735939863 93718 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1735941116 976444 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Taking a break from Lojban ontology today to show the youngsters how to Pyline properly. I have hacked up what I think is my smallest, slowest BF interp yet: https://gist.github.com/MostAwesomeDude/d0559414ace589c0536b219d2e086db7
< 1735941137 311916 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I'm about halfway through converting this to Pyline Classic but I need to recharge.
< 1735941189 411848 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I really wanted to avoid using a fixed-point combinator but I think that my options are: Z combinator for Python, locals() hacks, or bytecode with code() to hand-write a while-loop.
< 1735941530 54655 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I wonder whether that's faster or slower than my BF interpreter in Esimpl
< 1735941563 28518 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :although mine was implementing bignum BF, yours can easily be adapted to that
< 1735941640 329611 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(it ships with the Esimpl interpreter linked on the wiki, maybe I should make it a separate link)
< 1735941950 748950 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ais523: don't you have double exponentially slow bf interpreters for one of these machines with only counters?
< 1735942668 221603 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :possibly, although I'm not sure I ever actually wrote one
< 1735942686 819388 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I thought Esimpl would be an interesting comparison because the interpreter isn't hugely slow, but it is limited by having only stacks to store data in
< 1735942737 739225 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :if you pick a super-slow language it isn't an interesting comparison
< 1735942879 803282 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :yeah
< 1735942971 36512 :int-e!~noone@int-e.eu PRIVMSG #esolangs :So you can have 2 stacks for data and 2 stacks for tracking the program and one more stack for tracking loop depth while skipping back and forth?
< 1735943020 676441 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(trying to wrap my head around the utility of having more than 2 stacks... this kind of separation of concerns should help)
< 1735943076 526870 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it's implemented Underload-style, two for data, one for program, one for holding the current loop while making a copy of it (which is a full semideque not just a stack as it gets looped round twice), and one for counting nesting depth
< 1735943088 770311 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and one as a temporary while lexing
< 1735943544 150064 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735945185 583203 PRIVMSG #esolangs :14[[07User:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149346&oldid=149098 5* 03Waffelz 5* (-21) 10
< 1735948347 854460 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1735948681 110339 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1735949037 210111 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735949179 294703 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735955318 478303 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Well, I failed. I have a pile of code: https://bpa.st/LNJHYYC2ITORTPJT54NYCEAGXM
< 1735955352 44516 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It doesn't work. Or maybe it works? But it causes key errors that should be impossible on Lost Kingdom, which means I fucked something up in a dire way. Maybe the parser's shit.
< 1735955389 976213 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I can't get it to actually print out any non-trivial looping construct. mandel.b pegs my CPU and doesn't achieve anything.
< 1735955431 868576 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Anyway, good waste of an afternoon. Maybe there's something to learn from this.
< 1735955851 862109 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1735956687 17457 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1735957058 663807 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149347&oldid=149312 5* 03PrySigneToFry 5* (+89) 10
> 1735963241 557253 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149348&oldid=148833 5* 03PrySigneToFry 5* (+1128) 10/* Your username */ new section
> 1735963371 64738 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149349&oldid=148142 5* 03PrySigneToFry 5* (-23007) 10Clear the talking page
> 1735963412 146011 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Archive/2024 9 20 to 2025 1 414]]4 N10 02https://esolangs.org/w/index.php?oldid=149350 5* 03PrySigneToFry 5* (+23201) 10Archived
> 1735963445 986965 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Archive14]]4 10 02https://esolangs.org/w/index.php?diff=149351&oldid=139984 5* 03PrySigneToFry 5* (+28) 10
> 1735963744 379324 PRIVMSG #esolangs :14[[07UserEdited14]]4 10 02https://esolangs.org/w/index.php?diff=149352&oldid=149007 5* 03PrySigneToFry 5* (+289) 10
> 1735963782 473815 PRIVMSG #esolangs :14[[07UserEdited14]]4 10 02https://esolangs.org/w/index.php?diff=149353&oldid=149352 5* 03PrySigneToFry 5* (-1) 10
> 1735963872 693128 PRIVMSG #esolangs :14[[07PokBattle14]]4 M10 02https://esolangs.org/w/index.php?diff=149354&oldid=148563 5* 03PrySigneToFry 5* (+7) 10
> 1735966362 426653 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149355&oldid=149300 5* 03PrySigneToFry 5* (+99) 10
< 1735968301 952829 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1735968632 634245 PRIVMSG #esolangs :14[[07TapeFuck14]]4 M10 02https://esolangs.org/w/index.php?diff=149356&oldid=147869 5* 03PythonshellDebugwindow 5* (+94) 10Categories
> 1735968758 602010 PRIVMSG #esolangs :14[[07Queue-based esolang14]]4 M10 02https://esolangs.org/w/index.php?diff=149357&oldid=148160 5* 03PythonshellDebugwindow 5* (+104) 10Categories
> 1735968846 177860 PRIVMSG #esolangs :14[[07Def run(t):14]]4 M10 02https://esolangs.org/w/index.php?diff=149358&oldid=148033 5* 03PythonshellDebugwindow 5* (+14) 10Lowercase
> 1735969050 123119 PRIVMSG #esolangs :14[[07GotoLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149359&oldid=148201 5* 03PythonshellDebugwindow 5* (+92) 10Categories
> 1735969129 637958 PRIVMSG #esolangs :14[[07BrainfXX14]]4 M10 02https://esolangs.org/w/index.php?diff=149360&oldid=136886 5* 03PythonshellDebugwindow 5* (+38) 10See also
> 1735969276 789061 PRIVMSG #esolangs :14[[07The Genetic Computer14]]4 M10 02https://esolangs.org/w/index.php?diff=149361&oldid=148441 5* 03PythonshellDebugwindow 5* (+66) 10Categories
> 1735969386 873148 PRIVMSG #esolangs :14[[07Albuquerque challenge/exampled to itself14]]4 M10 02https://esolangs.org/w/index.php?diff=149362&oldid=148244 5* 03PythonshellDebugwindow 5* (+32) 10Back
> 1735970303 876371 PRIVMSG #esolangs :14[[07Brainrot14]]4 10 02https://esolangs.org/w/index.php?diff=149363&oldid=148267 5* 03PythonshellDebugwindow 5* (+102) 10Disambiguation
> 1735970411 185820 PRIVMSG #esolangs :14[[07Brainrot (Yayimhere)14]]4 M10 02https://esolangs.org/w/index.php?diff=149364&oldid=148273 5* 03PythonshellDebugwindow 5* (+163) 10Lowercase, categories
> 1735970444 178473 PRIVMSG #esolangs :14[[07Brainrot14]]4 M10 02https://esolangs.org/w/index.php?diff=149365&oldid=149363 5* 03PythonshellDebugwindow 5* (+0) 10Capitalisation
> 1735970644 512849 PRIVMSG #esolangs :14[[07Brainrot (Theothetruenerd)14]]4 10 02https://esolangs.org/w/index.php?diff=149366&oldid=148265 5* 03PythonshellDebugwindow 5* (+152) 10Categories, see also
> 1735970706 406284 PRIVMSG #esolangs :14[[07Gen Alpha14]]4 M10 02https://esolangs.org/w/index.php?diff=149367&oldid=133257 5* 03PythonshellDebugwindow 5* (+87) 10See also
> 1735970790 158016 PRIVMSG #esolangs :14[[07Gen Alpha Brainrot14]]4 M10 02https://esolangs.org/w/index.php?diff=149368&oldid=133258 5* 03PythonshellDebugwindow 5* (+78) 10See also
> 1735970846 667370 PRIVMSG #esolangs :14[[07Rizzlang14]]4 M10 02https://esolangs.org/w/index.php?diff=149369&oldid=136621 5* 03PythonshellDebugwindow 5* (+89) 10See also
> 1735971047 360462 PRIVMSG #esolangs :14[[0716x16 RGB2 panel14]]4 M10 02https://esolangs.org/w/index.php?diff=149370&oldid=148296 5* 03PythonshellDebugwindow 5* (+66) 10Categories
> 1735971279 894082 PRIVMSG #esolangs :14[[07User:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149371&oldid=149346 5* 03Waffelz 5* (+10) 10
> 1735972109 73397 PRIVMSG #esolangs :14[[07Mobius brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149372&oldid=148290 5* 03PythonshellDebugwindow 5* (+758) 10Link, interpreter, categories
> 1735972249 633830 PRIVMSG #esolangs :14[[07Mutual Modification Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149373&oldid=148325 5* 03PythonshellDebugwindow 5* (+68) 10Link, header, categories
> 1735972537 289347 PRIVMSG #esolangs :14[[07TuringLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149374&oldid=148390 5* 03PythonshellDebugwindow 5* (+63) 10Wikilink, categories
> 1735972999 861096 PRIVMSG #esolangs :14[[07Halting problem (language)14]]4 M10 02https://esolangs.org/w/index.php?diff=149375&oldid=148351 5* 03PythonshellDebugwindow 5* (+121) 10Categories
> 1735973451 340678 PRIVMSG #esolangs :14[[07Brainstack14]]4 M10 02https://esolangs.org/w/index.php?diff=149376&oldid=74712 5* 03PythonshellDebugwindow 5* (+57) 10Distinguish confusion
> 1735973774 461514 PRIVMSG #esolangs :14[[07Brainstack(islptng)14]]4 M10 02https://esolangs.org/w/index.php?diff=149377&oldid=148516 5* 03PythonshellDebugwindow 5* (+118) 10Categories
> 1735973839 491086 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149378&oldid=147888 5* 03PythonshellDebugwindow 5* (+49) 10Distinguish confusion
> 1735974408 753364 PRIVMSG #esolangs :14[[07Directions14]]4 M10 02https://esolangs.org/w/index.php?diff=149379&oldid=148707 5* 03PythonshellDebugwindow 5* (+205) 10Categories
> 1735975048 905233 PRIVMSG #esolangs :14[[07Brainstack(islptng)14]]4 10 02https://esolangs.org/w/index.php?diff=149380&oldid=149377 5* 03ZCX islptng 5* (-2) 10Wrong category!
< 1735978796 471453 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735982563 462663 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1735983633 421362 PRIVMSG #esolangs :14[[07Constructible14]]4 N10 02https://esolangs.org/w/index.php?oldid=149381 5* 03Hakerh400 5* (+1481) 10+[[Constructible]]
> 1735983663 354023 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149382&oldid=149275 5* 03Hakerh400 5* (+20) 10+[[Constructible]]
> 1735983680 69964 PRIVMSG #esolangs :14[[07User:Hakerh40014]]4 10 02https://esolangs.org/w/index.php?diff=149383&oldid=144748 5* 03Hakerh400 5* (+20) 10+[[Constructible]]
< 1735984076 541932 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735987854 618341 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735987995 933760 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds
> 1735988705 657465 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149384&oldid=149112 5* 03Jan jelo 5* (+832) 10
< 1735989093 188914 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1735989885 60886 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149385&oldid=149384 5* 03Jan jelo 5* (+657) 10
> 1735989931 413385 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149386&oldid=149385 5* 03Jan jelo 5* (+13) 10/* Looping */
> 1735990045 977739 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149387&oldid=149386 5* 03Jan jelo 5* (+13) 10/* Looping */
< 1735990524 831709 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1735990635 550263 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149388&oldid=149325 5* 03Jan jelo 5* (+1) 10/* Article */
< 1735992223 337576 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1735992291 492344 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735993452 998198 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :
< 1735993601 741568 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735996718 369454 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1735999098 34860 :molson_!~molson@2605-4A80-2101-99D0-876A-B6B9-AAA8-7CB-dynamic.midco.net JOIN #esolangs molson :realname
< 1735999299 383506 :molson!~molson@2605-4A80-2101-99D0-D3CE-EF6F-645F-64A7-dynamic.midco.net QUIT :Ping timeout: 276 seconds
< 1736002042 164771 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736005015 193552 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736006403 118700 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736006797 886850 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736007161 930382 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736008464 779604 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1736009079 641130 :Artea!~Lufia@artea.pt QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1736009953 553053 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
> 1736010438 519973 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Juanp32 5* 10New user account
< 1736010619 887976 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 264 seconds
> 1736011924 591526 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149389&oldid=149219 5* 03Juanp32 5* (+681) 10/* Introductions */
> 1736012192 652057 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 N10 02https://esolangs.org/w/index.php?oldid=149390 5* 03Juanp32 5* (+307) 10making userpage :)
< 1736012551 969553 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1736012728 998684 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736012737 81986 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :@metar EGBB
< 1736012744 146316 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs :Request failed.
< 1736012865 148607 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1736013396 743726 PRIVMSG #esolangs :14[[07Array?14]]4 10 02https://esolangs.org/w/index.php?diff=149391&oldid=146013 5* 0347 5* (-64) 10/* Commands */
> 1736013417 82278 PRIVMSG #esolangs :14[[07Array?14]]4 10 02https://esolangs.org/w/index.php?diff=149392&oldid=149391 5* 0347 5* (+8) 10/* Commands */
> 1736013561 910437 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149393&oldid=148522 5* 0347 5* (-1) 10/* Syntax */
< 1736013974 385043 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736014024 926277 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149394&oldid=149393 5* 0347 5* (+167) 10/* Hello, world! */
> 1736014223 373423 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149395&oldid=149394 5* 0347 5* (+92) 10/* Syntax */
< 1736014884 603339 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de QUIT :Quit: Leaving
> 1736014908 356556 PRIVMSG #esolangs :14[[07!aBF'14]]4 10 02https://esolangs.org/w/index.php?diff=149396&oldid=144515 5* 0347 5* (-1) 10golfed the truth-machine a bit more
> 1736014995 933959 PRIVMSG #esolangs :14[[07!lyriclydemoteestablishcommunism!14]]4 10 02https://esolangs.org/w/index.php?diff=149397&oldid=148748 5* 0347 5* (-70) 10the batch implementation has output
< 1736015044 962181 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de JOIN #esolangs * :rodgort
> 1736015065 490413 PRIVMSG #esolangs :14[[07!aBF'14]]4 10 02https://esolangs.org/w/index.php?diff=149398&oldid=149396 5* 0347 5* (+1) 10/* Examples */
> 1736015140 646437 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149399&oldid=141357 5* 0347 5* (+0) 10/* Syntax */
> 1736015154 778439 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149400&oldid=149399 5* 0347 5* (+0) 10/* Truth-machine */
> 1736015190 827081 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149401&oldid=149400 5* 0347 5* (+1) 10/* Syntax */
< 1736015458 138019 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736015562 621447 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1736015633 565391 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736015801 584173 PRIVMSG #esolangs :14[[07Queue-based esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149402&oldid=149357 5* 0347 5* (+57) 10/* Interpreters */
> 1736016083 78358 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149403&oldid=138739 5* 0347 5* (-34) 10/* Infinite loop */
> 1736016171 505243 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149404&oldid=149403 5* 0347 5* (-287) 10/* Truth-machine */
> 1736016195 621638 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149405&oldid=149404 5* 0347 5* (-22) 10/* Commands */
> 1736016337 737137 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149406&oldid=149405 5* 0347 5* (-125) 10/* Examples */
> 1736016398 821638 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149407&oldid=149406 5* 0347 5* (+68) 10/* Commands */
> 1736016544 680950 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149408&oldid=149407 5* 0347 5* (-22) 10
> 1736016562 513769 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149409&oldid=149408 5* 0347 5* (-8) 10/* Commands */
> 1736016842 411786 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149410&oldid=149409 5* 0347 5* (+35) 10/* Commands */
> 1736016939 420579 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149411&oldid=149410 5* 0347 5* (-44) 10/* Commands */
< 1736017356 15196 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736017926 907252 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736019425 504573 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Is there a way in GNU C to tell the compiler that a specific constant is that the compiler can assume that it remains constant while the program is running but is not allowed to assume what its value is at compile time (possibly because the value will be changed in the executable file before the program runs)?
< 1736019579 828691 :APic!apic@apic.name PRIVMSG #esolangs :Good Question
< 1736019582 115669 :APic!apic@apic.name PRIVMSG #esolangs :Good Night!
< 1736019757 397944 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: yes, I think if you declare a global variable as const then the compiler is allowed to assume that its value can't be changed but you can still use an initializer whose value isn't known at compiler time, such as a function call
< 1736019781 723784 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :in fact I think that works even for local variables
< 1736019889 165269 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but the actual object has to be declared const, just a const pointer doesn't guarantee that what it's pointing to can't change
< 1736019924 948198 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :For local variables that will make sense, but I mean whose value is initialized before the program runs (how this is done is not necessarily known to the compiler; one way would be modifying the executable file by something other than the compiler), so it is not initialized by a function call or something like that.
< 1736019976 963643 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :You can give it `extern` linkage while preserving the `const` modifiers. IIRC this is the right way to do it; you could pretend that the value is known to the linker but not the compiler.
< 1736019999 67403 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :OK
< 1736020053 283515 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :If the goal is to force the compiler to not do `volatile` or PLT reads all the time, though, I'm not sure. It'd definitely be a GNU-specific extension that I haven't seen before.
< 1736020117 583132 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: if the object isn't large then you could just make a copy into a const variable and use that copy
< 1736020156 357386 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but I don't think the compiler can do much global optimizations about the value being constant anyway
< 1736020162 803060 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :only local ones
< 1736020175 754653 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :there was also a relevant function attribute I think
< 1736020204 274545 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736020305 20361 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :https://gcc.gnu.org/onlinedocs/gcc-14.2.0/gcc/Common-Function-Attributes.html#index-const-function-attribute
< 1736020320 780286 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :the return value of such a function can't change throughout the program
< 1736020325 538890 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but that too only helps for small objects
< 1736021193 983594 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736022616 750025 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1736023004 969413 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736023660 262817 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736024484 433995 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736024992 928577 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736024993 247011 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 15.10, score 40.33, rank 3/47
< 1736025170 645541 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :two_thirds has a very similar win/loss profile to impatience2, because it's in the same general group of strategies, but should be more stable (impatience2 can be exploited by making a large change to your flag, two_thirds can't be)
< 1736025554 548044 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736026155 224735 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736026804 815240 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736028089 347627 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149412&oldid=149411 5* 03Ractangle 5* (+6) 10/* Truth-machine */
> 1736028311 959899 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149413&oldid=149068 5* 03Ractangle 5* (+153) 10/* $+-? */
> 1736030854 721237 PRIVMSG #esolangs :14[[07Sakana14]]4 10 02https://esolangs.org/w/index.php?diff=149414&oldid=133735 5* 03TheCanon2 5* (+230) 10Added warning
< 1736030893 392455 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736032113 498691 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736032274 396752 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736032319 366941 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1736032835 919972 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149415 5* 03Jan jelo 5* (+4013) 10Created page with "This python program by [[User:Jan jelo]] compiles Minsky machine program into [[Blindfolded Arithmetic]] program.(using state 0 means halt,states start from state 1.) It uses 2^a*3^b to encode two counters in 1736033063 349509 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149416&oldid=149415 5* 03Jan jelo 5* (+43) 10
> 1736033132 171141 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149417&oldid=149416 5* 03Jan jelo 5* (+17) 10
> 1736033154 30162 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149418&oldid=149417 5* 03Jan jelo 5* (+0) 10
> 1736033194 355765 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149419&oldid=149329 5* 03Jan jelo 5* (+0) 10
> 1736033235 673075 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149420&oldid=149086 5* 03TheCanon2 5* (+157) 10added debug version
> 1736033326 345258 PRIVMSG #esolangs :14[[07User talk:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149421&oldid=149127 5* 03Waffelz 5* (+86) 10/* waffelz' Talk Page */
> 1736035027 951318 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic14]]4 10 02https://esolangs.org/w/index.php?diff=149422&oldid=142352 5* 03Jan jelo 5* (+1206) 10/* Proof of Turing-completeness */
> 1736035217 350420 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic14]]4 10 02https://esolangs.org/w/index.php?diff=149423&oldid=149422 5* 03Jan jelo 5* (+6) 10/* Compile from Minsky machine */
< 1736035388 477542 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
> 1736035427 87741 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149424&oldid=149418 5* 03Jan jelo 5* (+681) 10
< 1736035513 968923 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1736035741 410094 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149425&oldid=149424 5* 03Jan jelo 5* (+6) 10
> 1736036429 757479 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149426&oldid=149388 5* 03Jan jelo 5* (+158) 10
> 1736036469 959490 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149427&oldid=149301 5* 03Jan jelo 5* (+21) 10
> 1736036693 670690 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149428&oldid=149427 5* 03Jan jelo 5* (+4) 10
> 1736037024 31283 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149429&oldid=149426 5* 03Jan jelo 5* (+23) 10
> 1736037041 66780 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149430&oldid=149429 5* 03Jan jelo 5* (+1) 10
> 1736037439 61990 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=149431&oldid=149328 5* 03Jan jelo 5* (+57) 10/* Brainfuck interpreter */
> 1736038490 773158 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149432&oldid=149425 5* 03Jan jelo 5* (-52) 10
> 1736039844 429122 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149433&oldid=149432 5* 03Jan jelo 5* (+3) 10
> 1736041754 666581 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=149434&oldid=148347 5* 03Jan jelo 5* (+87) 10/* Real Quines */
< 1736043152 274960 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736043644 532263 PRIVMSG #esolangs :14[[07Pytecode14]]4 N10 02https://esolangs.org/w/index.php?oldid=149435 5* 03BestCoder 5* (+306) 10Created page with "Python bytecode == examples == === hello world === 3 0 LOAD_GLOBAL 0 (print) 2 LOAD_CONST 1 ('hello world') 4 CALL_FUNCTION 1 6 POP_TOP 8 LOAD_CONST
> 1736044308 475143 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=149436&oldid=149434 5* 03Jan jelo 5* (+2358) 10/* Python (Python 3) */
> 1736044496 241333 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149437&oldid=149436 5* 03Jan jelo 5* (+0) 10/* Python (Python 3) */
< 1736046304 133339 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1736046322 375325 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736046335 105593 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
< 1736046394 585279 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
> 1736047701 721350 PRIVMSG #esolangs :14[[07Direction14]]4 10 02https://esolangs.org/w/index.php?diff=149438&oldid=138338 5* 03BestCoder 5* (+4) 10/* 321 program */
> 1736047724 455026 PRIVMSG #esolangs :14[[07Direction14]]4 10 02https://esolangs.org/w/index.php?diff=149439&oldid=149438 5* 03BestCoder 5* (+0) 10/* 321 program */
< 1736050267 304248 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736052344 924298 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=149440&oldid=133617 5* 03BestCoder 5* (+176) 10
< 1736052416 725864 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :The new calendar for this year does not have seasons
> 1736052545 670457 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=149441&oldid=149440 5* 03BestCoder 5* (+223) 10
> 1736059776 837719 PRIVMSG #esolangs :14[[07User:Tommyaweosme/BRING BACK THE OLD SANDBOX14]]4 10 02https://esolangs.org/w/index.php?diff=149442&oldid=149110 5* 03PrySigneToFry 5* (+70) 10
< 1736061418 439928 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736062109 992891 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736063252 593614 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736065078 896585 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736065631 974531 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736065711 425574 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736066574 743333 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: Textual IRC Client: www.textualapp.com
< 1736066600 858711 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736067497 874509 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736068405 232450 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
< 1736071051 985453 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736071612 472832 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Hashmark10]] to [[ITECAAPL]]
> 1736071675 71100 PRIVMSG #esolangs :14[[07ITECAAPL14]]4 10 02https://esolangs.org/w/index.php?diff=149445&oldid=149443 5* 0347 5* (+35) 10
> 1736072748 208640 PRIVMSG #esolangs :14[[07Ilo nanpa sitelen14]]4 N10 02https://esolangs.org/w/index.php?oldid=149446 5* 03EvyLah 5* (+406) 10create base page but I need to finish it later
> 1736072756 689654 PRIVMSG #esolangs :14[[07Ilo nanpa sitelen14]]4 M10 02https://esolangs.org/w/index.php?diff=149447&oldid=149446 5* 03EvyLah 5* (-1) 10
< 1736072878 383192 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736073741 680290 PRIVMSG #esolangs :14[[07OmegaLang14]]4 N10 02https://esolangs.org/w/index.php?oldid=149448 5* 03PrySigneToFry 5* (+8725) 10Created page with "OmegaLang is designed by PSTF. = Language Overview = OmegaLang is an object-oriented programming language that uses non-extreme-esoteric syntax to programming. It is powerful, and easy to learn but hard to complete mastery its principle. The language most inspi
> 1736074158 931231 PRIVMSG #esolangs :14[[07User talk:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff14]]4 10 02https://esolangs.org/w/index.php?diff=149449&oldid=149082 5* 03PrySigneToFry 5* (+783) 10
> 1736074297 9547 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149450&oldid=145256 5* 03PrySigneToFry 5* (+429) 10
> 1736074418 290843 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149451&oldid=148424 5* 03PrySigneToFry 5* (+441) 10/* To get code-golfing, I recommend to use the Base-100. */ new section
< 1736074712 202439 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736074876 980460 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149452&oldid=149413 5* 03PrySigneToFry 5* (+176) 10
> 1736075107 857721 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149453&oldid=131339 5* 03PrySigneToFry 5* (+286) 10
> 1736075417 339703 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149454&oldid=149453 5* 03PrySigneToFry 5* (+451) 10Both type 12 and type 13 are designed and implemented by PSTF.
> 1736075475 635982 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149455&oldid=149454 5* 03PrySigneToFry 5* (-8) 10Fixed interpreter
> 1736075598 285563 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149456&oldid=149455 5* 03PrySigneToFry 5* (+18) 10
< 1736075737 277360 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 244 seconds
< 1736075856 313030 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1736076705 643326 PRIVMSG #esolangs :14[[07JCLN14]]4 10 02https://esolangs.org/w/index.php?diff=149457&oldid=125659 5* 03Kaveh Yousefi 5* (+205) 10Introduced an examples section whose incipial member constitutes an odd-numbered line jumper.
> 1736076742 751951 PRIVMSG #esolangs :14[[07JCLN14]]4 10 02https://esolangs.org/w/index.php?diff=149458&oldid=149457 5* 03Kaveh Yousefi 5* (+157) 10Added a hyperlink to my implementation of the JCLN programming language on GitHub and altered the Unimplemented category tag to Implemented.
< 1736077107 27938 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1736078550 4057 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1736078715 476257 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736079534 334554 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :
< 1736079549 969981 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1736080252 590394 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736080711 301145 :APic!apic@apic.name PRIVMSG #esolangs :Celebrate Mungday! Hail Eris! 😇
> 1736084802 343131 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149459&oldid=149382 5* 03PrySigneToFry 5* (+16) 10/* O */
< 1736085068 304156 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot QUIT :Ping timeout: 244 seconds
< 1736085165 198583 :simcop2387!~simcop238@perlbot/patrician/simcop2387 QUIT :Ping timeout: 260 seconds
> 1736085210 895289 PRIVMSG #esolangs :14[[07+14]]4 10 02https://esolangs.org/w/index.php?diff=149460&oldid=141272 5* 03PrySigneToFry 5* (+119) 10
> 1736085568 2276 PRIVMSG #esolangs :14[[07Anti-Plushie language/PSTF14]]4 N10 02https://esolangs.org/w/index.php?oldid=149461 5* 03PrySigneToFry 5* (+565) 10Created page with "PSTF also have another APL(Anti-Plushie Language, not that APL). == Commands == It is same as brainfuck, except: # If your program contains ., then output then terminate. # If your program lets a cell to be 2 or 50, th
> 1736085639 628940 PRIVMSG #esolangs :14[[07User:PrySigneToFry/ constant14]]4 M10 02https://esolangs.org/w/index.php?diff=149462&oldid=142259 5* 03PrySigneToFry 5* (-2) 10
> 1736085712 876552 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=149463&oldid=142264 5* 03PrySigneToFry 5* (+103) 10
> 1736085993 339928 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149464&oldid=149331 5* 0347 5* (+25) 10/* Tommyawsome */
> 1736086024 7982 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149465&oldid=149464 5* 0347 5* (-43) 10/* Tommyawsome */
< 1736086116 301743 :simcop2387!~simcop238@perlbot/patrician/simcop2387 JOIN #esolangs simcop2387 :ZNC - https://znc.in
< 1736086196 429666 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot JOIN #esolangs perlbot :ZNC - https://znc.in
> 1736086646 746297 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149466&oldid=148357 5* 0347 5* (+66) 10
> 1736086658 203556 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149467&oldid=149466 5* 0347 5* (-1) 10
> 1736086868 286528 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149468&oldid=149467 5* 0347 5* (-1) 10/* Python3 */
< 1736087576 922989 :Everything!~Everythin@46-133-12-19.mobile.vf-ua.net JOIN #esolangs Everything :Everything
< 1736087795 702884 :Everything!~Everythin@46-133-12-19.mobile.vf-ua.net QUIT :Read error: Connection reset by peer
> 1736088437 865607 PRIVMSG #esolangs :14[[07Snakel/Syntax14]]4 10 02https://esolangs.org/w/index.php?diff=149469&oldid=147797 5* 0347 5* (+114) 10
> 1736088491 648297 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149470&oldid=149468 5* 0347 5* (-3) 10/* Python3 */
< 1736088649 276199 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736090438 788132 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149471&oldid=146627 5* 03Tommyaweosmalt 5* (+317) 10
> 1736090490 223346 PRIVMSG #esolangs :14[[07User:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=149472&oldid=143126 5* 03Tommyaweosmalt 5* (+122) 10
> 1736090916 455703 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149473&oldid=149471 5* 03ZCX islptng 5* (+648) 10/* */
> 1736091032 878110 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149474&oldid=149473 5* 03ZCX islptng 5* (+112) 10/* */
< 1736095275 611352 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1736096381 307713 PRIVMSG #esolangs :14[[07Lack14]]4 N10 02https://esolangs.org/w/index.php?oldid=149475 5* 03Dmiz 5* (+1572) 10Created page with "Lack is are an Esolang Based In Cells The Commands Are: {| class="wikitable" |+ |- ! Command !! Description |- | > || change the pointer by 1 |- | < || change the pointer by -1 |- | + || add 1 in pointer cell |- | - || subtract 1 in pointer cell |- | . || add ascii of poi
< 1736097151 258586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736097169 48059 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :you might know me as juanp32 on the wiki
< 1736097186 651 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :i made an esolang but i wanna name it before publishonh
< 1736097189 170594 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :https://pastebin.com/MnfniQ5s
< 1736097202 36953 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :any suggestions??
< 1736097278 288343 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :im out of ideas
< 1736097667 246363 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :ok seems like all of irc is dead today (even the usually active channels)
< 1736097680 264327 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736097768 33631 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736097773 587695 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
> 1736099235 749241 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149476&oldid=149286 5* 03Win7HE 5* (+38) 10/* Eso (redirect) */
> 1736099293 252964 PRIVMSG #esolangs :14[[07Hyperinotoidion14]]4 10 02https://esolangs.org/w/index.php?diff=149477&oldid=148204 5* 03Win7HE 5* (+0) 10
> 1736099338 951208 PRIVMSG #esolangs :14[[07Template talk:Stub14]]4 10 02https://esolangs.org/w/index.php?diff=149478&oldid=112080 5* 03Win7HE 5* (+280) 10
> 1736100334 756595 PRIVMSG #esolangs :14[[07Emmental/Printing Code That Prints Code14]]4 N10 02https://esolangs.org/w/index.php?oldid=149479 5* 03Win7HE 5* (+4370) 10Created page with "its pretty large #35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#46.#35.#53.#54.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#
> 1736100365 173036 PRIVMSG #esolangs :14[[07Emmental/Printing Code That Prints Code14]]4 10 02https://esolangs.org/w/index.php?diff=149480&oldid=149479 5* 03Win7HE 5* (+13) 10
> 1736100757 668808 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149481&oldid=149475 5* 03Dmiz 5* (+323) 10
> 1736100777 266991 PRIVMSG #esolangs :14[[07Branjunk14]]4 10 02https://esolangs.org/w/index.php?diff=149482&oldid=138857 5* 03Win7HE 5* (-2) 10code stuff and stuff like grammar
> 1736100942 56985 PRIVMSG #esolangs :14[[07Tommyaweosme unary14]]4 10 02https://esolangs.org/w/index.php?diff=149483&oldid=137203 5* 03Win7HE 5* (+113) 10
> 1736100984 823915 PRIVMSG #esolangs :14[[07Tommyaweosme unary14]]4 10 02https://esolangs.org/w/index.php?diff=149484&oldid=149483 5* 03Win7HE 5* (+80) 10
> 1736101100 180485 PRIVMSG #esolangs :14[[07Talk:Branjunk14]]4 N10 02https://esolangs.org/w/index.php?oldid=149485 5* 03Win7HE 5* (+106) 10Created page with "i decided to make changes --~~~~"
> 1736101251 57333 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=149486&oldid=148829 5* 03Win7HE 5* (+90) 10
< 1736101466 61255 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736101518 356722 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 N10 02https://esolangs.org/w/index.php?oldid=149487 5* 03Win7HE 5* (+56) 10Created page with " {{:Special:Random}}"
> 1736101565 555451 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149488&oldid=149487 5* 03Win7HE 5* (+19) 10
> 1736101724 93411 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149489&oldid=149488 5* 03Win7HE 5* (+32) 10
> 1736101775 986453 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149490&oldid=149489 5* 03Win7HE 5* (-1) 10
< 1736101845 146586 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1736101911 915132 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1736102040 299545 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149491&oldid=149490 5* 03Win7HE 5* (+96) 10
> 1736102123 125267 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149492&oldid=149491 5* 03Win7HE 5* (+20) 10
> 1736102183 259237 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149493&oldid=149492 5* 03Win7HE 5* (-80) 10
> 1736102268 333996 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149494&oldid=149493 5* 03Win7HE 5* (+30) 10
< 1736102997 823408 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736103240 703738 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 10 02https://esolangs.org/w/index.php?diff=149495&oldid=149187 5* 03Dmiz 5* (+59) 10
> 1736103487 582464 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149496&oldid=149481 5* 03Dmiz 5* (-1) 10
> 1736104223 267971 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Placeholding 5* 10New user account
< 1736104288 81784 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds
> 1736105401 281675 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149497&oldid=149389 5* 03Placeholding 5* (+435) 10
< 1736106185 422959 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736106920 30496 PRIVMSG #esolangs :14[[07User:Placeholding14]]4 N10 02https://esolangs.org/w/index.php?oldid=149498 5* 03Placeholding 5* (+67) 10Created page with "hello. welcome to my user page.
i have nothing else to say here"
< 1736107649 900502 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736107851 921373 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736108932 856619 PRIVMSG #esolangs :14[[07This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 M10 02https://esolangs.org/w/index.php?diff=149499&oldid=120450 5* 03TheCanon2 5* (+18) 10category
< 1736109204 720587 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736109215 301287 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736110290 90289 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736110398 281869 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1736110624 105076 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736110749 957033 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736111686 169309 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149500&oldid=149452 5* 03Jan jelo 5* (+161) 10/* Muriel */
> 1736111769 603418 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149501&oldid=149228 5* 03Jan jelo 5* (+168) 10/* Examples */
< 1736113105 376664 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736113289 964320 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736115579 830673 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736115776 196339 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736116625 941111 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736117328 20721 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1736117469 725358 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736119872 319656 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1736119875 488643 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736119885 922343 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1736121826 495881 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736121924 948544 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736121981 377567 :chiselfu1e!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1736122116 136608 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Ping timeout: 264 seconds
< 1736123039 465626 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
> 1736123841 14306 PRIVMSG #esolangs :14[[07This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 M10 02https://esolangs.org/w/index.php?diff=149502&oldid=149499 5* 03PkmnQ 5* (+4) 10
> 1736127906 698818 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149503&oldid=149450 5* 03ZCX islptng 5* (+924) 10
> 1736129182 850976 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149504&oldid=149503 5* 03ZCX islptng 5* (+15) 10
> 1736129560 380231 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149505&oldid=149504 5* 03ZCX islptng 5* (+105) 10
> 1736130693 234521 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149506&oldid=149505 5* 03ZCX islptng 5* (+438) 10
> 1736131293 679933 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149507&oldid=149506 5* 03ZCX islptng 5* (+15) 10
> 1736131547 793861 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149508&oldid=149507 5* 03ZCX islptng 5* (+1140) 10
> 1736131859 183405 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149509&oldid=149508 5* 03ZCX islptng 5* (+223) 10
< 1736132633 611917 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Remote host closed the connection
> 1736132805 390014 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03ZCX islptng 5* 10moved [[02SLet10]] to [[SLet (Old 2)]]
> 1736132818 119293 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149512&oldid=149511 5* 03ZCX islptng 5* (-26) 10Blanked the page
> 1736132886 84598 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149513&oldid=148680 5* 03ZCX islptng 5* (-10) 10
> 1736132962 314308 PRIVMSG #esolangs :14[[07SLet (Old 2)14]]4 10 02https://esolangs.org/w/index.php?diff=149514&oldid=149510 5* 03ZCX islptng 5* (-73) 10
> 1736133030 334849 PRIVMSG #esolangs :14[[07SLet (Old)14]]4 10 02https://esolangs.org/w/index.php?diff=149515&oldid=146586 5* 03ZCX islptng 5* (+29) 10
> 1736133155 598298 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149516&oldid=149512 5* 03ZCX islptng 5* (+156) 10
> 1736133202 758761 PRIVMSG #esolangs :14[[07Uhidklol14]]4 N10 02https://esolangs.org/w/index.php?oldid=149517 5* 03Juanp32 5* (+2636) 10make this page now that ive named it
> 1736133218 957481 PRIVMSG #esolangs :14[[07SLet/Implementation14]]4 10 02https://esolangs.org/w/index.php?diff=149518&oldid=149197 5* 03ZCX islptng 5* (+10801) 10Undo revision [[Special:Diff/149197|149197]] by [[Special:Contributions/ZCX islptng|ZCX islptng]] ([[User talk:ZCX islptng|talk]])
> 1736133234 415345 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03ZCX islptng 5* 10moved [[02SLet/Implementation10]] to [[SLet (Old 2)/Implementation]]
> 1736133245 463793 PRIVMSG #esolangs :14[[07SLet/Implementation14]]4 10 02https://esolangs.org/w/index.php?diff=149521&oldid=149520 5* 03ZCX islptng 5* (-33) 10Removed redirect to [[SLet (Old 2)/Implementation]]
> 1736133271 94536 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149522&oldid=149459 5* 03Juanp32 5* (+15) 10/* U */
> 1736133272 889119 PRIVMSG #esolangs :14[[07SLet (Old 2)14]]4 10 02https://esolangs.org/w/index.php?diff=149523&oldid=149514 5* 03ZCX islptng 5* (-2) 10
> 1736133665 830316 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149524&oldid=149390 5* 03Juanp32 5* (+51) 10
> 1736133767 395389 PRIVMSG #esolangs :14[[07Uhidklol14]]4 M10 02https://esolangs.org/w/index.php?diff=149525&oldid=149517 5* 03Juanp32 5* (+13) 10oooops had to fix a typo
> 1736134469 739025 PRIVMSG #esolangs :14[[07Uhidklol14]]4 M10 02https://esolangs.org/w/index.php?diff=149526&oldid=149525 5* 03Juanp32 5* (+245) 10made the info a bit clearer, pluss added an entry to the list
> 1736134504 721872 PRIVMSG #esolangs :14[[07Talk:ABPLWNL14]]4 10 02https://esolangs.org/w/index.php?diff=149527&oldid=132149 5* 03BestCoder 5* (+371) 10/* actually you can "loop" forever unconditionally */ new section
< 1736135340 916459 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 252 seconds
< 1736140282 437488 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Optinyuroki: points 15.50, score 40.24, rank 3/47 (+1)
> 1736141146 571816 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149528&oldid=149516 5* 03ZCX islptng 5* (+1456) 10
> 1736141804 906931 PRIVMSG #esolangs :14[[07BF Lite14]]4 10 02https://esolangs.org/w/index.php?diff=149529&oldid=120288 5* 03BestCoder 5* (+27) 10
> 1736141824 185926 PRIVMSG #esolangs :14[[07Category:MistakeInSpec14]]4 N10 02https://esolangs.org/w/index.php?oldid=149530 5* 03BestCoder 5* (+35) 10Created page with "when you make a mistake in the spec"
> 1736142629 139091 PRIVMSG #esolangs :14[[07Talk:Autism14]]4 N10 02https://esolangs.org/w/index.php?oldid=149531 5* 03BestCoder 5* (+81) 10Created page with "I feel kinda offended ~~~"
> 1736143484 205395 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149532&oldid=149528 5* 03ZCX islptng 5* (+976) 10
> 1736144074 121105 PRIVMSG #esolangs :14[[07Talk:Asd14]]4 N10 02https://esolangs.org/w/index.php?oldid=149533 5* 03BestCoder 5* (+41) 10Created page with "doesnt that mean autism spectrum disorder"
> 1736144103 318132 PRIVMSG #esolangs :14[[07Esolang testing14]]4 N10 02https://esolangs.org/w/index.php?oldid=149534 5* 03BestCoder 5* (+1) 10Created page with "e"
> 1736144113 279106 PRIVMSG #esolangs :14[[07Talk:Esolang testing14]]4 N10 02https://esolangs.org/w/index.php?oldid=149535 5* 03BestCoder 5* (+623) 10Created page with "--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~"
< 1736146562 140530 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736148094 485309 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149536&oldid=149532 5* 03ZCX islptng 5* (+34) 10
< 1736152348 728448 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :Remote host closed the connection
< 1736152664 902499 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736152689 95135 :b_jonas!~x@88.87.242.184 QUIT :Ping timeout: 265 seconds
< 1736152792 442392 :b_jonas!~x@88.87.242.184 JOIN #esolangs * :b_jonas
> 1736155452 68277 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149537&oldid=149456 5* 03None1 5* (-2) 10/* Dialects created in 2025 */
> 1736155595 928828 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149538&oldid=149537 5* 03None1 5* (+142) 10/* Example Programs */ Add examples
> 1736155674 957272 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149539&oldid=149538 5* 03None1 5* (+113) 10/* Type 13 */
> 1736155764 473640 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149540&oldid=149539 5* 03None1 5* (+122) 10/* Type 13 */
> 1736155785 364980 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149541&oldid=149540 5* 03None1 5* (-19) 10/* type 11/Nil/APLWSI interpreter */
> 1736155835 737438 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149542&oldid=149541 5* 03None1 5* (+170) 10/* Interpreters */
> 1736155873 91459 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149543&oldid=149542 5* 03None1 5* (+27) 10
> 1736156683 385325 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149544&oldid=149500 5* 03None1 5* (+24) 10/* Type 1 and Type 2 and Type 6 and Type 7 and Type 9 and Type 10 */
> 1736156766 705540 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149545&oldid=149544 5* 03None1 5* (+12) 10/* Type 3 and Type 5 and Type 8 */
< 1736157301 410160 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736158511 227647 PRIVMSG #esolangs :14[[07Void14]]4 N10 02https://esolangs.org/w/index.php?oldid=149546 5* 03None1 5* (+2167) 10Created page with "'''Void''' is [[User:None1]]'s first esolang (that isn't a dialect of an old esolang) invented in 2025. ==Types== This esolang is an untyped one as it has only 1 type: '''void'''. Unlike the type with the same name in most practical languages, this type can not only store em
> 1736158540 965197 PRIVMSG #esolangs :14[[07Void14]]4 10 02https://esolangs.org/w/index.php?diff=149547&oldid=149546 5* 03None1 5* (+4) 10
> 1736158629 838158 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149548&oldid=149522 5* 03None1 5* (+11) 10/* V */
> 1736158715 808784 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149549&oldid=148986 5* 03None1 5* (+57) 10/* My Esolangs */
< 1736159273 681165 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736159820 224864 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736159960 677433 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736160060 738987 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736160527 330712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736161248 251713 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736163950 564137 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :how do people typically combine macros in a language like lambda calculus?
< 1736163974 58838 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :no, let me rephrase
< 1736163997 404424 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :i have a language that has variables and named macros
< 1736164021 211941 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :they're not functions so i don't have proper scoping for variables
< 1736164065 926943 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :how do i do something like f(f(a,b), f(c,d)) without them stepping on each other's toes?
< 1736165070 8899 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1736165112 679214 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736165365 926199 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :I don't think you can, if you mean that the "call" f(a,b) and the one for f(c,d) clobber the same variables
< 1736165407 544185 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :or well hm, I guess if you transform it to a form where everything is done serially? foo = f(a,b); bar = f(c,d); baz = f(foo, bar); and generate uniue names for each intermediate stage
< 1736165588 389646 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1736166037 284789 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736166079 2104 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :isabella: I think you may be looking for "hygienic macros", see https://en.wikipedia.org/wiki/Hygienic_macro
< 1736166230 188889 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :i think i'm going to go with a stack
> 1736168887 159568 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03RedstoneMedia 5* 10New user account
> 1736168989 159894 PRIVMSG #esolangs :14[[07User:Jan jelo/ASK calculus interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=149550 5* 03Jan jelo 5* (+1701) 10Created page with "This is a stack-based [[Ask-calculus]] interpreter in Python by [[User:Jan jelo]].
def pop(x,l): a=l.pop() x.append(a) if a==')': i=1 while i: a=l[-1] x.append(l.pop()) if a=='(':i-=1 if a==')':i+=1 return y=[];
< 1736169176 233111 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736169176 510578 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 15.90, score 42.60, rank 3/47 (+1)
> 1736169316 517997 PRIVMSG #esolangs :14[[07User:Jan jelo/ASK calculus interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=149551&oldid=149550 5* 03Jan jelo 5* (+35) 10
> 1736169368 566954 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149552&oldid=149430 5* 03Jan jelo 5* (+44) 10/* Intepreters */
< 1736169454 745080 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736169454 962946 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 16.10, score 42.96, rank 3/47 (--)
> 1736170195 122734 PRIVMSG #esolangs :14[[07Void14]]4 10 02https://esolangs.org/w/index.php?diff=149553&oldid=149547 5* 03None1 5* (+2) 10/* =Named functions */
< 1736170225 459720 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736170225 660317 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 16.26, score 43.38, rank 2/47 (+1)
< 1736170651 37268 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1736171291 934768 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149554&oldid=149451 5* 03None1 5* (+557) 10/* To get code-golfing, I recommend to use the Base-100. */
< 1736172941 690720 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736172941 879788 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 17.88, score 47.69, rank 2/47 (--)
> 1736173420 453665 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Jan jelo 5* 10moved [[02User:Jan jelo/ASK calculus interpreter10]] to [[User:Jan jelo/SKA calculus interpreter]]
> 1736173452 265521 PRIVMSG #esolangs :14[[07User:Jan jelo/SKA calculus interpreter14]]4 10 02https://esolangs.org/w/index.php?diff=149557&oldid=149555 5* 03Jan jelo 5* (+13) 10
> 1736173701 808469 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 N10 02https://esolangs.org/w/index.php?oldid=149558 5* 03Juanp32 5* (+3854) 10im bored and randomly got this idea
> 1736173802 538544 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149559&oldid=149548 5* 03Juanp32 5* (+78) 10/* Non-alphabetic */
> 1736173818 894888 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149560&oldid=149552 5* 03Jan jelo 5* (+0) 10/* Intepreters */
> 1736173996 454249 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 10 02https://esolangs.org/w/index.php?diff=149561&oldid=149558 5* 03Juanp32 5* (+195) 10please tell me in what list this should go in the talk page
> 1736174067 265478 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149562&oldid=149561 5* 03Juanp32 5* (+6) 10oooops formatting
> 1736174140 221384 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149563&oldid=149562 5* 03Juanp32 5* (+18) 10DANGIT ACCIDENTALLY CLICKED SAVE INSTEAD OF PREVIEW lets assume both header and list edits were the same edit k?
> 1736174333 789740 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149564&oldid=149563 5* 03Juanp32 5* (+0) 10this is it im not editing on mobile ever again. fat fingers i keep misclicking >:/
< 1736174744 726049 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1736175181 95957 PRIVMSG #esolangs :14[[07IRC14]]4 M10 02https://esolangs.org/w/index.php?diff=149565&oldid=85668 5* 03Juanp32 5* (+0) 10/* Reserved words */ typo, said "voided" instead of "voiced"
< 1736175199 846722 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :typos suck
< 1736175455 612401 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736175455 899898 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.93, score 50.35, rank 2/47 (--)
> 1736175648 785727 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149566&oldid=149536 5* 03ZCX islptng 5* (+100) 10
< 1736175835 441163 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736176666 931184 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736178239 660028 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736178704 609266 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736179007 428609 :molson__!~molson@2605-4A80-2101-99D0-168C-5969-D579-98E-dynamic.midco.net JOIN #esolangs molson :realname
> 1736179072 163892 PRIVMSG #esolangs :14[[07BF Joust strategies14]]4 10 02https://esolangs.org/w/index.php?diff=149567&oldid=149115 5* 03Ais523 5* (+2068) 10/* Cleared decoy detection */ a few of my programs have done this now and it seems pretty helpful in general in fact, there are enough programs doing this to provide a metagame of countermeasures, and countermeasures to the countermeasures
> 1736179084 762245 PRIVMSG #esolangs :14[[07Talk:This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 N10 02https://esolangs.org/w/index.php?oldid=149568 5* 03Aadenboy 5* (+362) 10Created page with "184 characters for an among us joke,, truly the demise of the british empire ~~~~"
< 1736179186 140433 :molson_!~molson@2605-4A80-2101-99D0-876A-B6B9-AAA8-7CB-dynamic.midco.net QUIT :Ping timeout: 248 seconds
< 1736179997 388856 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, two_thirds now ties with one program but beats all the rest, but nonetheless isn't in first place because many of the wins are very narrow
< 1736180042 73387 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think that's probably correct; in a sense, backstop2 is "more impressive" because it beats most programs by large margins
< 1736180267 369297 :molson__!~molson@2605-4A80-2101-99D0-168C-5969-D579-98E-dynamic.midco.net QUIT :Quit: Leaving
< 1736180469 429512 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net JOIN #esolangs molson :realname
< 1736181696 502193 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net QUIT :Remote host closed the connection
< 1736181724 577217 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net JOIN #esolangs molson :realname
< 1736183910 358942 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :https://gist.github.com/izabera/8c541886c3992d328255944bc3de62c7 the thing from a few hours ago
< 1736184733 249015 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 244 seconds
< 1736185557 126583 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736186035 879746 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736186284 719293 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736187311 381959 :APic!apic@apic.name PRIVMSG #esolangs :Good Night!
> 1736187533 463343 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149569&oldid=149496 5* 03Dmiz 5* (+135) 10
> 1736187979 665160 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149570&oldid=149569 5* 03Dmiz 5* (+86) 10
< 1736188322 144733 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736188410 888338 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 272 seconds
< 1736188501 713545 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736188840 809278 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149571&oldid=149570 5* 03Dmiz 5* (-10) 10
< 1736190862 819353 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736191954 946919 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149572&oldid=149497 5* 03Buckets 5* (+327) 10
> 1736192007 862135 PRIVMSG #esolangs :14[[07Javagrid14]]4 M10 02https://esolangs.org/w/index.php?diff=149573&oldid=65225 5* 03Buckets 5* (+1) 10
< 1736192303 736384 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736193251 185424 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736193399 512029 PRIVMSG #esolangs :14[[07ETA14]]4 10 02https://esolangs.org/w/index.php?diff=149574&oldid=106485 5* 03Buckets 5* (+120) 10
< 1736194161 446251 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736194429 724285 PRIVMSG #esolangs :14[[07W)14]]4 M10 02https://esolangs.org/w/index.php?diff=149575&oldid=141114 5* 03Buckets 5* (+2) 10
< 1736194917 312719 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :isabella: Delightful, thanks for sharing.
< 1736195131 287712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736195397 267474 :__monty__!~toonn@user/toonn QUIT :Ping timeout: 244 seconds
< 1736195439 435520 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net QUIT :Ping timeout: 260 seconds
< 1736195992 190769 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736196240 526707 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 N10 02https://esolangs.org/w/index.php?oldid=149576 5* 03Jan jelo 5* (+1901) 10Created page with "This is a [[JSFuck]] code generator in python by [[User:Jan jelo]]. false='(![])' true=f'!{false}' _0=f'(+[])' _1=f'(+{true})' succ=lambda x:f'({x}+{_1})' _2=succ(_1) _3=succ(_2) _4=f'({_2}+{_2})' _5=f'({_2}+{_3})' _6=f'({_3}+{_3})' _7
> 1736196346 734163 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149577&oldid=149576 5* 03Jan jelo 5* (+10) 10
> 1736196627 45248 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149578&oldid=149577 5* 03Jan jelo 5* (+27) 10
> 1736196702 857318 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149579&oldid=149560 5* 03Jan jelo 5* (+0) 10typo
< 1736196959 129907 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736197060 289197 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149580&oldid=149579 5* 03Jan jelo 5* (+41) 10/* Code generators */
> 1736197483 985002 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149581&oldid=149437 5* 03Jan jelo 5* (+22) 10/* Python (Python 3) */
> 1736197578 590636 PRIVMSG #esolangs :14[[07User:Jan jelo/a quine in python that contains a underload interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=149582 5* 03Jan jelo 5* (+2407) 10Created page with "This is a [[Quine]] program in python by [[User:Jan jelo]]. It contains a [[Underload]] interpreter. def run(p): stack=[] program=p while program: x,program=program[0],program[1:]
> 1736197662 872328 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149583&oldid=149580 5* 03Jan jelo 5* (+87) 10
> 1736197939 421864 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149584&oldid=149465 5* 03Ractangle 5* (-6) 10/* Stuff to continue */
> 1736197987 1125 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149585&oldid=149584 5* 03Ractangle 5* (-8) 10/* Stuff to continue */
< 1736198211 595184 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736198212 536909 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149586&oldid=149578 5* 03Jan jelo 5* (-16) 10
> 1736198248 405099 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149587&oldid=149586 5* 03Jan jelo 5* (-1) 10
> 1736198277 251417 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Ractangle 5* 10moved [[02ITECAAPL10]] to [[Marb]]
> 1736198329 260535 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149590&oldid=149588 5* 03Ractangle 5* (-104) 10finishing this later
> 1736199731 874037 PRIVMSG #esolangs :14[[07User:Jan jelo/SKA calculus interpreter14]]4 10 02https://esolangs.org/w/index.php?diff=149591&oldid=149557 5* 03Jan jelo 5* (+193) 10
< 1736199960 986270 :molson!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 JOIN #esolangs molson :realname
< 1736199996 67223 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736200053 227625 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
< 1736200137 350757 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736201881 960322 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736201915 683586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736201979 534389 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736202467 76273 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736202483 677202 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736203046 967566 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736203448 436724 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149592&oldid=148332 5* 03Juanp32 5* (+171) 10
< 1736203668 339473 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736206528 471893 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149593&oldid=149524 5* 03Juanp32 5* (+149) 10since i made 2 languages i guess its time to make a list amirite
< 1736208244 655182 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1736208332 333657 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736209986 477241 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736210073 56251 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149594&oldid=149571 5* 03Dmiz 5* (+63) 10
< 1736210485 932538 :chiselfu1e!~chiselfus@user/chiselfuse NICK :chiselfuse
< 1736213405 578094 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Optinyuroki: points 16.57, score 42.00, rank 3/47 (+1)
< 1736215848 435252 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736215856 118456 :Bowserinator_!Bowserinat@hellomouse/dev/bowserinator QUIT :Read error: Connection reset by peer
< 1736216741 384513 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736218497 274555 :ming!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736219348 22943 :molson_!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 JOIN #esolangs molson :realname
< 1736219413 108233 :ming!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 248 seconds
< 1736219494 973664 :molson!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 QUIT :Ping timeout: 260 seconds
< 1736219824 237027 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736224812 435096 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 246 seconds
< 1736224926 416143 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736225120 904725 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
< 1736225128 453392 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736225288 454493 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Max SendQ exceeded
< 1736225364 444824 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736230549 114987 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 248 seconds
< 1736234339 233329 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736235090 412424 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736235694 776720 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03I am islptng 5* 10New user account
> 1736235732 645959 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149595&oldid=149572 5* 03I am islptng 5* (+146) 10
> 1736235809 426061 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng10]] to [[User:I am islptng]]
> 1736235809 461010 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/List of "x bits, y bytes"10]] to [[User:I am islptng/List of "x bits, y bytes"]]
> 1736235809 501148 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/My rate to the user I know10]] to [[User:I am islptng/My rate to the user I know]]
> 1736235809 537027 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/Redirect10]] to [[User:I am islptng/Redirect]]
> 1736235809 573102 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/Sandbox10]] to [[User:I am islptng/Sandbox]]
> 1736235809 604610 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/TCP110]] to [[User:I am islptng/TCP1]]
> 1736235809 633090 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User:ZCX islptng/Template:Signature10]] to [[User:I am islptng/Template:Signature]]
> 1736235809 666348 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User talk:ZCX islptng10]] to [[User talk:I am islptng]]
> 1736235809 699995 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5* 10moved [[02User talk:ZCX islptng/Sandbox10]] to [[User talk:I am islptng/Sandbox]]
> 1736235884 754161 PRIVMSG #esolangs :14[[07Template:User:ZCX islptng/Signature14]]4 10 02https://esolangs.org/w/index.php?diff=149614&oldid=147102 5* 03I am islptng 5* (-476) 10Blanked the page
> 1736236266 762425 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149615&oldid=148156 5* 03I am islptng 5* (+592) 10/* Please ban User:ZCX islptng. */ new section
> 1736237047 59689 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149616&oldid=149596 5* 03I am islptng 5* (+223) 10
> 1736237093 741209 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149617&oldid=149616 5* 03I am islptng 5* (+4) 10
> 1736237674 160967 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149618&oldid=149617 5* 03I am islptng 5* (+73) 10
> 1736238028 681518 PRIVMSG #esolangs :14[[07User:I am islptng/List of the users that is also in conwaylife.com14]]4 N10 02https://esolangs.org/w/index.php?oldid=149619 5* 03I am islptng 5* (+429) 10Created page with "I welcome everybody that is both on conwaylife.com and esolangs.org to edit it!
Incomplete list {|class=wikitable ! Esolangs.org name !! LifeWiki name !! ConwayLife Forums name !! How |- | I am islptng
> 1736240298 201469 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149620&oldid=149590 5* 0347 5* (+77) 10
< 1736241339 889422 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736242756 48354 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736245132 11181 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds
< 1736245513 829485 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1736246049 47270 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149621&oldid=149620 5* 0347 5* (+87) 10
< 1736247134 113712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736250226 540353 PRIVMSG #esolangs :14[[07!@$%^&*()+=14]]4 10 02https://esolangs.org/w/index.php?diff=149622&oldid=148771 5* 03Xyzzy 5* (+12) 10
> 1736250408 450043 PRIVMSG #esolangs :14[[07User:Xyzzy/Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149623 5* 03Xyzzy 5* (+3) 10Created page with "idk"
< 1736251352 273413 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1736251577 404243 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736252206 46183 PRIVMSG #esolangs :14[[07614]]4 10 02https://esolangs.org/w/index.php?diff=149624&oldid=145396 5* 0347 5* (-73) 10/* Online interpreters */
> 1736253174 135296 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Truthmachine.png10]]": Truth Machine for ChromaCode
> 1736253427 215929 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Catstr.png10]]": String Cat Program for ChromaCode
> 1736253480 543525 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Catnum.png10]]": Number Cat Program for ChromaCode
> 1736253568 902012 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Xkcd221.png10]]": XKCD RNG for ChromaCode
> 1736253709 349429 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Fibonacci.png10]]"
> 1736253746 483951 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 10 02https://esolangs.org/w/index.php?diff=149630&oldid=149564 5* 0347 5* (+41) 10/* errors */
> 1736253921 266927 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Factorial.png10]]"
> 1736254035 961937 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Listevennumbers.png10]]"
> 1736254106 194290 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Iseven.png10]]"
> 1736254195 738501 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Hi.png10]]"
> 1736254801 850456 PRIVMSG #esolangs :14[[07ChromaCode14]]4 N10 02https://esolangs.org/w/index.php?oldid=149635 5* 03QuantumV 5* (+3317) 10Create page
> 1736254951 123401 PRIVMSG #esolangs :14[[07ChromaCode14]]4 M10 02https://esolangs.org/w/index.php?diff=149636&oldid=149635 5* 03QuantumV 5* (-6) 10
> 1736255035 421790 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149637&oldid=149559 5* 03QuantumV 5* (+18) 10add chromacode
> 1736255063 612365 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149638&oldid=149637 5* 03QuantumV 5* (-1) 10
> 1736255506 213374 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=149639&oldid=148642 5* 03QuantumV 5* (+80) 10add chromacode
> 1736255566 790216 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149640&oldid=149545 5* 03QuantumV 5* (+89) 10add chromacode
> 1736255795 822750 PRIVMSG #esolangs :14[[07ChromaCode14]]4 10 02https://esolangs.org/w/index.php?diff=149641&oldid=149636 5* 03QuantumV 5* (+213) 10better description
< 1736259193 376496 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736260170 661770 PRIVMSG #esolangs :14[[07fuck14]]4 10 02https://esolangs.org/w/index.php?diff=149642&oldid=133904 5* 03None1 5* (-1) 10/* Induct */
> 1736260663 124619 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149643&oldid=149378 5* 03None1 5* (+151) 10/* Cat program */
> 1736260730 954610 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149644&oldid=149643 5* 03None1 5* (+4) 10/* Overview */
> 1736261134 674269 PRIVMSG #esolangs :14[[07TMMLPTEALPAITAFNFAL14]]4 10 02https://esolangs.org/w/index.php?diff=149645&oldid=110906 5* 03Win7HE 5* (+11) 10/* External resources */
> 1736261375 552104 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149646&oldid=149621 5* 03Ractangle 5* (+484) 10
> 1736261550 114736 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149647&oldid=149646 5* 03Ractangle 5* (+37) 10/* Syntax */
< 1736264438 241729 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736264541 516936 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`olist 1316
< 1736264545 450782 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :olist : shachaf oerjan Sgeo boily nortti b_jonas Noisytoot
< 1736264980 462025 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds
> 1736265562 232207 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149648&oldid=147453 5* 03Win7HE 5* (+138) 10/* Original Command */
> 1736265591 136942 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149649&oldid=149648 5* 03Win7HE 5* (-138) 10/* Original Command */
> 1736265659 756938 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149650&oldid=149649 5* 03Win7HE 5* (+176) 10/* Additions */
> 1736265693 656690 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149651&oldid=149650 5* 03Win7HE 5* (+3) 10/* 99 bottles of beers */
> 1736265813 210397 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149652&oldid=149651 5* 03Win7HE 5* (+18) 10
< 1736265883 287797 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736265902 941275 PRIVMSG #esolangs :14[[07Talk:Dir14]]4 N10 02https://esolangs.org/w/index.php?oldid=149653 5* 03Juanp32 5* (+275) 10bro. if you dont put any info on an esolang besides "i made this" then dont make the page at all. it makes no sense. at least write some basic documentation in the page
> 1736266175 612739 PRIVMSG #esolangs :14[[07Talk:2025!14]]4 N10 02https://esolangs.org/w/index.php?oldid=149654 5* 03Win7HE 5* (+117) 10Created page with "swhrenndid you create this esyoolang --~~~~"
< 1736266289 897524 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736266341 728884 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736266342 49364 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--)
< 1736266390 323218 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736266390 508268 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--)
< 1736266407 948347 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :now beats every other program but is still in second place :-)
< 1736266529 272240 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust backstop2 <
< 1736266529 399043 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.backstop2: points -46.00, score 0.00, rank 47/47 (-46)
< 1736266546 685231 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust backstop2 http://nethack4.org/pastebin/backstop2.bfjoust
< 1736266547 14039 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.backstop2: points 22.62, score 61.20, rank 1/47 (+46)
> 1736266593 266974 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149655&oldid=149280 5* 03Calculus is fun 5* (+778) 10Added more examples related to repeat.
> 1736266868 945505 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149656&oldid=149655 5* 03Calculus is fun 5* (-2) 10word change
> 1736267009 317264 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149657&oldid=149615 5* 03Ais523 5* (+280) 10/* Please ban User:ZCX islptng. */ that doesn't need a ban
< 1736267438 876903 :int-e!~noone@int-e.eu PRIVMSG #esolangs :"ntroduction to Prolog: A Programming Language for AI"
< 1736267442 15160 :int-e!~noone@int-e.eu PRIVMSG #esolangs :...right
< 1736267449 55708 :int-e!~noone@int-e.eu PRIVMSG #esolangs :+I
< 1736267493 270262 :int-e!~noone@int-e.eu PRIVMSG #esolangs :https://prologyear.logicprogramming.org/ may be a factor too
< 1736267623 789444 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i mean, that kinda was the case back when "ai" wasn27
< 1736267633 101011 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :wasnt a buzzword for gpt
< 1736267655 769783 :int-e!~noone@int-e.eu PRIVMSG #esolangs :or neural networks
< 1736267683 239958 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :or that, yes
< 1736267686 230044 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I associate this with early AI efforts... expert systems.
< 1736267697 742099 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :but for querying knowledge databases in prolog is great
< 1736267708 565646 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i would love for curry to be more mainstream, though
< 1736267714 730837 :int-e!~noone@int-e.eu PRIVMSG #esolangs :but that article is from 2022 ;)
< 1736267738 427123 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Or 2023. Link: https://builtin.com/software-engineering-perspectives/prolog
< 1736267752 785438 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :thats kinda late to the party
< 1736267844 430417 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh it has an "Example AI Application of Prolog"
< 1736267862 730476 :int-e!~noone@int-e.eu PRIVMSG #esolangs :scary
< 1736267933 529896 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :incredible artificial intelligence at work
< 1736267934 949069 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(yes, medical diagnoses are all black or white and Prolog is the perfect tool for *achoo* that)
> 1736268257 893322 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149658&oldid=149099 5* 03Ais523 5* (+3990) 10/* 2025 */ add ais523.two_thirds
> 1736268307 225311 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 M10 02https://esolangs.org/w/index.php?diff=149659&oldid=149658 5* 03Ais523 5* (-1) 10/* 2025 */ grammar
< 1736268582 899577 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736268583 162282 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.83, score 50.17, rank 2/47 (--)
< 1736268619 434171 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i recently learned about lean and i am somewhat excited about that
> 1736268761 954783 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149660&oldid=149659 5* 03Ais523 5* (+106) 10/* 2025 */ mention the 3-cycle clear; also fix the explanation of the fast rush (the program was buggy and was also fixed to match the explanation, improving its score slightly)
> 1736268812 201277 PRIVMSG #esolangs :14[[07Talk:2025!14]]4 10 02https://esolangs.org/w/index.php?diff=149661&oldid=149654 5* 03Aadenboy 5* (+384) 10
> 1736268919 229155 PRIVMSG #esolangs :14[[07!@$%^&*()+14]]4 M10 02https://esolangs.org/w/index.php?diff=149662&oldid=144952 5* 03Aadenboy 5* (-1) 10
> 1736269037 978531 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149663&oldid=149660 5* 03Ais523 5* (+449) 10/* 2025 */ mention the trail innovation
< 1736269076 840103 :int-e!~noone@int-e.eu PRIVMSG #esolangs :What a great hotkey you picked there, Twitch... alt-T would never do anything in a browser. (Firefox has a _T_ools menu)
> 1736270932 956572 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149664&oldid=149595 5* 03Galvandi 5* (+391) 10/* Introductions */
> 1736271132 634173 PRIVMSG #esolangs :14[[07User:Galvandi/Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149665 5* 03Galvandi 5* (+4) 10Created page with "Test"
< 1736272875 320781 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736273252 540526 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :int-e: see that's your mistake, yer supposed to use a dedicated browser for it (well, in the form of electron)
< 1736273286 483495 :int-e!~noone@int-e.eu PRIVMSG #esolangs :electron, my arch-nemesis
< 1736273332 605495 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(unrelated... but there's so many games that use electron but only provide windows and macos executables and wine chokes on electron apps)
< 1736273372 143331 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(the irony of electron being supposedly portable is not lost on me)
< 1736273778 185959 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736274290 868414 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 272 seconds
< 1736274449 938560 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :I wonder how hard it would be to write something to "convert" such an executable to something that can be readily run.. I guess the tricky part would be dependencies on dll's and similar
< 1736274758 506165 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736274814 483167 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds
< 1736274934 325750 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736274953 562590 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:Dominoscript-logo.png10]]"
> 1736275172 162425 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=149667&oldid=149639 5* 03Jan jelo 5* (+197) 10/* Implementations */
> 1736275231 721029 PRIVMSG #esolangs :14[[07Recs14]]4 10 02https://esolangs.org/w/index.php?diff=149668&oldid=148410 5* 03Jan jelo 5* (+3) 10/* Example */
< 1736276770 798850 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I think there are better ways to make portable programs anyways
< 1736276782 797345 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Although, it also depends on what you expect the program to do)
> 1736277005 555764 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=149669&oldid=148686 5* 03Jan jelo 5* (+149) 10/* Example programs */
< 1736277087 210542 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736277339 205191 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript noop code visual representation .png10]]"
> 1736277573 924979 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149671&oldid=149669 5* 03Jan jelo 5* (-6) 10/* Example programs */
> 1736278070 181803 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149672&oldid=149647 5* 0347 5* (+39) 10/* Implementation */
> 1736278983 174504 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149673&oldid=149672 5* 0347 5* (+19) 10/* Syntax */
< 1736279321 185956 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Read error: Connection reset by peer
< 1736279336 266505 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1736280268 180357 PRIVMSG #esolangs :14[[07User:RocketRace14]]4 10 02https://esolangs.org/w/index.php?diff=149674&oldid=148585 5* 03RocketRace 5* (-52) 10
> 1736280589 996172 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-003-flow.png10]]"
< 1736285246 112428 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736285814 998531 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736286443 539380 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149676&oldid=149585 5* 03Ractangle 5* (-14) 10/* Stuff to continue */
> 1736286504 623377 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149677&oldid=149337 5* 03Ractangle 5* (+24) 10/* Esolangs */
> 1736286584 597751 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149678&oldid=149673 5* 03Ractangle 5* (+52) 10/* Examples */
> 1736286749 667407 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149679&oldid=149640 5* 03Ractangle 5* (+43) 10/* Malbolge Unshackled */
< 1736287079 695909 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736288796 128406 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Ping timeout: 264 seconds
< 1736288834 20693 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1736289519 855286 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149680&oldid=149656 5* 03Calculus is fun 5* (+308) 10Restructuring
> 1736290734 716811 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149681&oldid=149652 5* 03Juanp32 5* (+287) 10/* Additions */
> 1736290943 10677 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149682&oldid=149681 5* 03Juanp32 5* (+53) 10/* Programs */
> 1736291002 781465 PRIVMSG #esolangs :14[[07Free Esolang14]]4 M10 02https://esolangs.org/w/index.php?diff=149683&oldid=149682 5* 03Juanp32 5* (+13) 10ooooops forgot a tag
< 1736292791 66041 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736293263 253464 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736294547 253486 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736294703 839289 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736297637 432689 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 N10 02https://esolangs.org/w/index.php?oldid=149684 5* 03PkmnQ 5* (+1103) 10Created page with "The [[Kolakoski sequence]] is a sequence of 1's and 2's such that if you take the lengths of each run of the sequence, the result is the same as the original sequence. There are actually two sequences that fit this definition with their only difference being a
> 1736300542 729214 PRIVMSG #esolangs :14[[07Tiny14]]4 M10 02https://esolangs.org/w/index.php?diff=149685&oldid=108815 5* 03Ron.hudson 5* (+63) 10Add github page
< 1736301426 36417 :int-e!~noone@int-e.eu PRIVMSG #esolangs :@oeis 1,2,4,8,16,31
< 1736301426 402077 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs : Sequence not found.
< 1736301439 132900 :int-e!~noone@int-e.eu PRIVMSG #esolangs :ACTION wonders how long *that* has been broken
< 1736301496 673220 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(for a stupid reason too; http://oeis.org/search forcefully redirects to HTTPS)
< 1736301946 616283 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :@metar EGBB
< 1736301946 830485 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs :Request failed.
< 1736302473 138290 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Yeah I know that one broke too.
< 1736302938 739888 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Wow that API endpoint is completely different now.
< 1736302957 60219 :int-e!~noone@int-e.eu PRIVMSG #esolangs :And also does the mandatory HTTPS thing which is annoying.
< 1736303770 988178 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736304284 289504 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Unfortunately many servers have mandatory HTTPS and I think that they shouldn't do that (but they won't believe me, I think).
> 1736304309 159280 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNumerals.png10]]": numerals zero through nine
< 1736304328 911837 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Gemini protocol has only TLS, and some others that some people had make up also decide the same thing, even though I think that is no good. I wrote Scorpion protocol to specify that a server is not supposed to have mandatory TLS (except files that require a client certificate to access).)
< 1736304383 849185 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Hm. So, sorry if I'm repeating myself. (Brain damage is a literary device, etc.) There are several standard problems on the wiki which are well-known enough to serve as general-purpose comparison points: truth machine, quine, etc. Do we have an embarassingly-parallel problem?
< 1736304419 337928 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I don't know, but perhaps they should have
< 1736304443 757121 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :The idea would be to hack out something like a Mandelbrot set to show off parallelism in a language or toolkit. Mandelbrot might not be the best because it's graphical, chaotic, and possibly too expensive.
> 1736304485 178644 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNumerals.png10]]": padding fix
> 1736307573 920361 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNop.png10]]": small square
> 1736307607 535800 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInput.png10]]": downward half-barbed arrow
> 1736307626 838524 PRIVMSG #esolangs :14[[07User:Aadenboy/Draft14]]4 N10 02https://esolangs.org/w/index.php?oldid=149690 5* 03Aadenboy 5* (+2533) 10[[Kawa]] draft
< 1736307779 100190 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: FizzBuzz is almost embarassingly parallel, apart from the I/O
< 1736307803 264340 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but in general I'd expect such programs to parallelize well only by chance as the people who create them probably have single-threaded imperative languages in mind
< 1736307876 396505 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: That's not terrible, although yeah, the I/O's kind of important since it has to be serialized correctly.
< 1736307967 973001 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Concretely, suppose I want to show off how Cello makes C threading and mutexes easy. I was going to do something like write a little FIFO queue, put the pixels into the queue or maybe write an iterator for it, and then have a threadpool which consumes the pixels.
< 1736307974 806293 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But that sounds like a lot of code for a little wiki demo.
< 1736309491 683743 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I guess a good simple demo would be to map a function over a large range of integers and sum the results, although I'm not sure offhand what functions would be easy to implement and yet not allow you to get the sum into closed form
< 1736309495 419356 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :anyway, I should go to bed
< 1736309502 5334 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736312734 376331 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam
< 1736321138 621599 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :perlbot oeis 1,2,4,8,16,31
< 1736321139 222841 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot PRIVMSG #esolangs :b_jonas: http://oeis.org/searchs?q=1%2C2%2C4%2C8%2C16%2C31 A102726(1/72) Number of compositions of the integer n into positive parts that avoid a fixed pattern of three letters.: 1,1,2,4,8,16,31,60,114,214,398,732,1334,2410,4321,7688,13590,23869,41686,72405,125144,215286,368778,629156,1069396,1811336,3058130,5147484,8639976,14463901,24154348,40244877,669115... [Output truncated. http://perl.bot/p/5eyflq ]
< 1736321141 725476 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :int-e: ^
< 1736321188 606538 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :though for this search there are lots of hits so you'll need more terms
> 1736322245 734076 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-Factorial-flow.png10]]"
< 1736322368 653823 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736322650 741838 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-WASD-Input-Example-Flow.png10]]"
< 1736323498 144966 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736323719 940486 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736326910 886143 PRIVMSG #esolangs :14[[07DominoScript14]]4 N10 02https://esolangs.org/w/index.php?oldid=149693 5* 03Galvandi 5* (+7719) 10initial dominoscript documentation
< 1736326987 477353 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736327210 764986 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149694&oldid=149693 5* 03Galvandi 5* (+9487) 10Adding new sections
> 1736327350 873470 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149695&oldid=149694 5* 03Galvandi 5* (+30788) 10Added section about instructions
> 1736327447 796282 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149696&oldid=149695 5* 03Galvandi 5* (+15827) 10Added section about NavigatioModes & Examples
> 1736327946 381197 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149697&oldid=149638 5* 03Galvandi 5* (+19) 10Added DominoScript to the list
> 1736328075 181285 PRIVMSG #esolangs :14[[07User:Galvandi14]]4 N10 02https://esolangs.org/w/index.php?oldid=149698 5* 03Galvandi 5* (+63) 10Initial my user page
< 1736332407 296160 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736332657 462184 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736333034 74429 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736334133 536585 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=149699&oldid=149684 5* 03None1 5* (+1004) 10/* Examples */ add brainfuck
> 1736334512 878998 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=149700&oldid=149699 5* 03None1 5* (+156) 10/* brainfuck */
< 1736334671 104574 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736337277 408779 PRIVMSG #esolangs :14[[07User:I am islptng/Template:Signature14]]4 10 02https://esolangs.org/w/index.php?diff=149701&oldid=149608 5* 03I am islptng 5* (+478) 10
< 1736337771 434809 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 246 seconds
< 1736337907 77366 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736339330 374732 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736339601 922838 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149702&oldid=149549 5* 03None1 5* (+67) 10/* My Esolangs */
> 1736339723 377664 PRIVMSG #esolangs :14[[07User:None114]]4 M10 02https://esolangs.org/w/index.php?diff=149703&oldid=149702 5* 03None1 5* (+0) 10/* My Esolangs */ Oh I almost forgot
< 1736339973 279267 :APic!apic@apic.name PRIVMSG #esolangs :Hi
> 1736340614 987001 PRIVMSG #esolangs :14[[07Whole14]]4 N10 02https://esolangs.org/w/index.php?oldid=149704 5* 03None1 5* (+375) 10Created page with "'''Whole''' is an esolang invented by [[User:None1]]. It is a version of [[]] that uses English letters. ==Commands== Whole Corresponding word _______________________________ h hole q question e exclamation w warning
==E
> 1736340733 286834 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149705&oldid=149704 5* 03None1 5* (+107) 10
> 1736340781 696957 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149706&oldid=111983 5* 03None1 5* (+26) 10/* Example Programs */
> 1736340809 402623 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149707&oldid=149706 5* 03None1 5* (-2) 10/* See also */
> 1736341506 855428 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149708&oldid=149705 5* 03None1 5* (+306) 10
> 1736341640 38968 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149709&oldid=149708 5* 03None1 5* (+2) 10/* Variants */ not i
> 1736341845 489011 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149710&oldid=149709 5* 03None1 5* (+87) 10/* Examples */
> 1736342121 473838 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=149711&oldid=147971 5* 03None1 5* (+53) 10/* General languages */
> 1736342172 226729 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149712&oldid=149703 5* 03None1 5* (+54) 10/* My Esolangs */
> 1736342314 25162 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149713&oldid=149349 5* 03None1 5* (+362) 10
> 1736342475 535270 PRIVMSG #esolangs :14[[07!I!M!P!O!S!S!I!B!L!E!14]]4 10 02https://esolangs.org/w/index.php?diff=149714&oldid=108657 5* 03None1 5* (+15) 10
> 1736342565 255833 PRIVMSG #esolangs :14[[07Template:Infobox proglang14]]4 10 02https://esolangs.org/w/index.php?diff=149715&oldid=126878 5* 03None1 5* (+25) 10
> 1736342593 791883 PRIVMSG #esolangs :14[[07!I!M!P!O!S!S!I!B!L!E!14]]4 M10 02https://esolangs.org/w/index.php?diff=149716&oldid=149714 5* 03None1 5* (-15) 10
> 1736342738 196578 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149717&oldid=149707 5* 03None1 5* (+18) 10/* See also */ add year
< 1736343661 7611 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736345299 439918 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ZachChecksOutEsolangs 5* 10uploaded "[[02File:OK FINE!!!.png10]]": The logo for the "OK FINE!!!" esolang
> 1736345973 860435 PRIVMSG #esolangs :14[[07Talk:Whole14]]4 N10 02https://esolangs.org/w/index.php?oldid=149719 5* 03I am islptng 5* (+597) 10Created page with "I think you misspelled the title. whole adj. hole n. ~~~~"
> 1736346462 302203 PRIVMSG #esolangs :14[[07^14]]4 10 02https://esolangs.org/w/index.php?diff=149720&oldid=139345 5* 03I am islptng 5* (+114) 10
< 1736346669 33479 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736346684 612549 PRIVMSG #esolangs :14[[07^Romn14]]4 N10 02https://esolangs.org/w/index.php?oldid=149721 5* 03I am islptng 5* (+1723) 10Created page with "{| class="wikitable" |+ Commands |- ! Romanian !! English !! Meaning |- | Spune "[text]" || Print "[text]" || Prints a string of text |- | Spune [variabilul] || Output [variable] || Outputs the value of a variable |- | Ia [variabilul] || Input [variable] / Enter [var
> 1736346831 944096 PRIVMSG #esolangs :14[[07Talk:^Romn14]]4 N10 02https://esolangs.org/w/index.php?oldid=149722 5* 03I am islptng 5* (+597) 10Created page with "[[^]]~~~~"
< 1736346931 198100 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :
> 1736347143 694767 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149723&oldid=149657 5* 03I am islptng 5* (+93) 10/* Please ban User:ZCX islptng. */
> 1736347532 135299 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149724&oldid=149723 5* 03Ais523 5* (+238) 10/* Please ban User:ZCX islptng. */ MediaWiki isn't designed to replace old links to userpages
> 1736347672 925707 PRIVMSG #esolangs :14[[07User talk:Ais523/Archive214]]4 N10 02https://esolangs.org/w/index.php?oldid=149725 5* 03Ais523 5* (+61405) 10archiving my talk page
> 1736347680 716240 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149726&oldid=149724 5* 03Ais523 5* (-61373) 10archiving
> 1736348914 762559 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149727&oldid=149726 5* 03I am islptng 5* (+88) 10/* Please ban User:ZCX islptng. */
< 1736350361 77626 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1736350915 483530 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149728&oldid=149592 5* 03Juanp32 5* (+124) 10/* Commands */
> 1736350999 676591 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149729&oldid=149728 5* 03Juanp32 5* (+0) 10TYPO ARGH
< 1736351433 788281 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736351822 976029 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149730&oldid=149727 5* 03Aadenboy 5* (+369) 10/* Please ban User:ZCX islptng. */
< 1736351867 644667 :citrons!~citrons@alt.mondecitronne.com QUIT :Ping timeout: 244 seconds
> 1736351988 165602 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNumerals.png10]]": add background
> 1736352018 103026 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNop.png10]]": add background
> 1736352039 825721 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaInput.png10]]": add background
> 1736352145 419332 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutput.png10]]": upward right-barbed arrow
< 1736352224 509973 :citrons!~citrons@alt.mondecitronne.com JOIN #esolangs citrons :citrons
> 1736352224 735104 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaConditionals.png10]]": slanted line with bisecting horizontal segment
> 1736352329 582010 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaJumps.png10]]": 45 angle with vertical segment underneath
< 1736352783 410774 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736355027 478423 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierWithTwo.png10]]": left bar diacritic
> 1736355054 173534 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierLimit.png10]]": top bar diacritic
> 1736355075 916424 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierAsOne.png10]]": right bar diacritic
> 1736355097 887168 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierNegate.png10]]": bottom bar diacritic
> 1736355979 444729 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149741&oldid=149663 5* 03Ais523 5* (-16) 10/* 2025 */ clarify
> 1736356066 509526 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149742&oldid=149741 5* 03Ais523 5* (+0) 10/* 2025 */ fix an incorrect word
> 1736356652 585456 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierSequentially.png10]]": left downward-barbed arrow
> 1736358346 252936 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03AdjectiveNounNumber 5* 10New user account
> 1736359410 677347 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149744&oldid=149664 5* 03AdjectiveNounNumber 5* (+181) 10
> 1736359445 217352 PRIVMSG #esolangs :14[[07User talk:AdjectiveNounNumber14]]4 N10 02https://esolangs.org/w/index.php?oldid=149745 5* 03AdjectiveNounNumber 5* (+1) 10Created page with "e"
< 1736360798 872241 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736360859 983903 :APic!apic@apic.name PRIVMSG #esolangs :cu
> 1736360967 465432 PRIVMSG #esolangs :14[[07Convert14]]4 N10 02https://esolangs.org/w/index.php?oldid=149746 5* 03AdjectiveNounNumber 5* (+28) 10Created page with "{{wrongtitle|title=->}} WIP"
< 1736361190 130234 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736361297 558176 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1736361297 654806 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736362410 234752 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam
> 1736362761 745792 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149747&oldid=149746 5* 03AdjectiveNounNumber 5* (+752) 10
< 1736363116 989287 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736363241 573612 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalse10]] to [[Befalse (Ian Osgood)]]: thought of making a language with the same name so...
> 1736363269 306136 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02TIB-472 Calculator10]] to [[Befalse (Ractangle)]]
> 1736363419 358343 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149752&oldid=149750 5* 0347 5* (-277) 10will come up with syntax later
> 1736363575 860523 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopConcatenate.png10]]": nop + with two
> 1736363592 617505 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopAbsoluteValue.png10]]": nop + limit
> 1736363614 633242 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopBooleanify.png10]]": nop + as one
> 1736363629 240860 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopNegate.png10]]": nop + negate
> 1736363651 206541 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopModulo.png10]]": nop + with two + limit
> 1736363684 461637 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopAdd.png10]]": nop + with two + as one
> 1736363705 137821 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSplit.png10]]": nop + with two + negate
> 1736363770 369893 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopFirstDigit.png10]]": nop + limit + as one
> 1736363800 197996 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopRound.png10]]": nop + limit + negate
> 1736363817 604273 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSign.png10]]": nop + as one + negate
> 1736363854 379103 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopMaximum.png10]]": nop + with two + limit + as one
> 1736363862 275312 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149764&oldid=149752 5* 0347 5* (+280) 10
> 1736363886 463038 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopDivide.png10]]": nop + with two + as one + negate
> 1736363909 970471 PRIVMSG #esolangs :14[[07File:KawaNopDivide.png14]]4 M10 02https://esolangs.org/w/index.php?diff=149766&oldid=149765 5* 03Aadenboy 5* (-1) 10/* Summary */ wrong
> 1736363936 15198 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSubtract.png10]]": nop + with two + as one + negate
> 1736363960 437357 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopLastDigit.png10]]": nop + limit + as one + negate
> 1736363987 896504 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopMinimum.png10]]": nop + with two + limit + as one + negate
> 1736364635 5273 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149770&oldid=149764 5* 0347 5* (-58) 10/* Commands */
> 1736364650 158883 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149771&oldid=149770 5* 0347 5* (-12) 10/* Commands */
> 1736364795 232823 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149772&oldid=149771 5* 0347 5* (+28) 10/* Commands */
> 1736366285 532737 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149773&oldid=149676 5* 0347 5* (-11) 10/* Stuff to continue */
> 1736366313 187899 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move_redir10 02 5* 0347 5* 10moved [[02Befalse (Ian Osgood)10]] to [[Befalse]] over redirect
> 1736366313 202497 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete_redir10 02 5* 0347 5* 1047 deleted redirect [[02Befalse10]] by overwriting: Deleted to make way for move from "[[Befalse (Ian Osgood)]]"
> 1736366341 19070 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalse (Ractangle)10]] to [[Befalsia]]
> 1736366370 44908 PRIVMSG #esolangs :14[[07Befalsia14]]4 10 02https://esolangs.org/w/index.php?diff=149778&oldid=149776 5* 0347 5* (-6) 10
< 1736366435 504993 :visilii_!~visilii@188.254.110.9 JOIN #esolangs * :ZNC - https://znc.in
> 1736366636 805716 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149779&oldid=149747 5* 03AdjectiveNounNumber 5* (+116) 10
< 1736366680 73437 :visilii!~visilii@213.24.125.237 QUIT :Ping timeout: 265 seconds
> 1736367260 508141 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149780&oldid=149779 5* 03AdjectiveNounNumber 5* (+93) 10
< 1736367358 62898 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736367471 772879 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736367519 227218 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149781&oldid=149780 5* 03AdjectiveNounNumber 5* (-28) 10
> 1736367551 488854 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149782&oldid=149781 5* 03AdjectiveNounNumber 5* (-3) 10
> 1736367612 430799 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149783&oldid=149782 5* 03AdjectiveNounNumber 5* (+45) 10
> 1736368516 443542 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149784&oldid=149680 5* 03Calculus is fun 5* (+1835) 10Added Input and output
> 1736368622 349793 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149785&oldid=149784 5* 03Calculus is fun 5* (-12) 10/* IO & strings */
< 1736369034 603282 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1736369058 360010 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149786&oldid=149785 5* 03Calculus is fun 5* (+239) 10/* Behavior */
> 1736369173 163481 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149787&oldid=149786 5* 03Calculus is fun 5* (+2) 10moved 99bobotw example
> 1736369590 572267 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03AceDoesStuff 5* 10New user account
< 1736369603 695131 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736371825 477618 PRIVMSG #esolangs :14[[07Uhidklol14]]4 10 02https://esolangs.org/w/index.php?diff=149788&oldid=149526 5* 03Juanp32 5* (+32) 10/* instructions */ added `q` command (which is shamelessly stolen off ed(1) lol)
> 1736372018 423396 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputWithTwo.png10]]": input + with two
> 1736372042 369992 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputLimit.png10]]": input + limit
> 1736372068 932093 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputLimitSequentially.png10]]": input + limit + sequentially
< 1736373088 267552 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736373776 3818 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736374079 743372 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736377342 995686 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149792&oldid=149787 5* 03Calculus is fun 5* (+205) 10Added a cat *meow*
> 1736377468 795992 PRIVMSG #esolangs :14[[07Talk:Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149793&oldid=149719 5* 03None1 5* (+396) 10
< 1736378285 919242 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736380977 99121 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736381066 441009 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736381189 969408 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736382793 398405 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149794&oldid=119744 5* 03Kaveh Yousefi 5* (+12) 10Rectified a few logical errors in the example programs 99 bottles of beer and Factorial, as well as an aesthetical blemish in the FizzBuzz example.
> 1736382904 914837 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149795&oldid=149794 5* 03Kaveh Yousefi 5* (+199) 10Added a hyperlink to my implementation of the Meow programming language on GitHub and supplemented the Implemented category tag.
> 1736383345 758650 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputAsOne.png10]]": input + as one
> 1736383356 458860 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149797&oldid=149795 5* 03Kaveh Yousefi 5* (+208) 10Supplemented references to the register names in the instruction table and reformatted operations as code fragments.
> 1736383364 965507 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaLimitNegate.png10]]": kawa + limit + negate
> 1736383393 435804 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputWithTwo.png10]]": output + with two
> 1736383424 634755 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputLimitAsOne.png10]]": output + limit + as one
> 1736383442 545143 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputAsOne.png10]]": output + as one
> 1736383463 941136 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputNegate.png10]]": output + negate
> 1736383485 446727 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputSequentially.png10]]": output + sequentially
> 1736383506 242276 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfWithTwo.png10]]": if + with two
> 1736383525 73599 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfLimit.png10]]": if + limit
> 1736383541 195217 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfNegate.png10]]": if + negate
> 1736383568 349313 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentially.png10]]": if + sequentially
> 1736383589 214578 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentiallyAsOne.png10]]": if + sequentially + as one
> 1736383611 473478 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentiallyWithTwo.png10]]": if + sequentially + with two
< 1736385762 82717 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 265 seconds
< 1736385848 520628 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1736386212 237514 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticSequentially.png10]]": left downward-barbed arrow
> 1736386241 425322 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPushTop.png10]]": upward chevron
> 1736386261 494319 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPushBottom.png10]]": upward arch
> 1736386284 918079 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPopTop.png10]]": downward chevron
> 1736386304 320944 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPopBottom.png10]]": downward arch
> 1736386332 677923 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticAsTwo.png10]]": diaeresis
> 1736386352 198287 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticDiscard.png10]]": squiggle
> 1736386751 925703 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaHelloWorld.png10]]": [[Hello, World!]] in [[Kawa]]
< 1736387067 34826 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds
< 1736387911 467443 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736387968 492623 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaFibonacci.png10]]": [[Fibonacci sequence]] in [[Kawa]]
> 1736387996 509459 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticFlag.png10]]": short T
> 1736388196 241977 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaTruthMachine.png10]]": [[Truth-machine]] in [[Kawa]]
> 1736388228 678131 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaCat.png10]]": [[Cat program]] in [[Kawa]]
> 1736388300 278584 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaJumpBack.png10]]"
< 1736390617 424775 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736391151 928181 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736391490 187738 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736394043 326447 PRIVMSG #esolangs :14[[07Kawa14]]4 N10 02https://esolangs.org/w/index.php?oldid=149823 5* 03Aadenboy 5* (+9826) 10Created page with "{{infobox proglang |name=Kawa |paradigms=? |author=[[User:Aadenboy]] |year=[[:Category:2025|2025]] |memsys=Deque, stack |dimensions=One-dimensional |refimp=[https://github.com/aadenboy/Kawa-IDE aadenboy/Kawa-IDE] |class=[[:Category:Turing complete|Turing complete]] 1736394094 69387 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=149824&oldid=149123 5* 03Aadenboy 5* (+70) 10/* MY ESOLANGS */ add [[Kawa]]
> 1736394152 395070 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149825&oldid=149697 5* 03Aadenboy 5* (+11) 10/* K */ add [[Kawa]]
> 1736394187 574487 PRIVMSG #esolangs :14[[07Semi-serious language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149826&oldid=148517 5* 03Aadenboy 5* (+11) 10/* K */ add Kawa
< 1736394505 564208 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, *that's* why they needed all of those images.
> 1736394914 912984 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (H-M)14]]4 M10 02https://esolangs.org/w/index.php?diff=149827&oldid=145778 5* 03Aadenboy 5* (+42) 10add [[Kawa]]
> 1736395012 639056 PRIVMSG #esolangs :14[[07Truth-machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149828&oldid=149679 5* 03Aadenboy 5* (+45) 10add [[Kawa]]
> 1736395059 892812 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=149829&oldid=149823 5* 03Aadenboy 5* (+31) 10distinguish confusion
> 1736395079 51726 PRIVMSG #esolangs :14[[07Kava14]]4 M10 02https://esolangs.org/w/index.php?diff=149830&oldid=141031 5* 03Aadenboy 5* (+31) 10distinguish confusion
< 1736396028 43972 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 265 seconds
< 1736402555 476229 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736406534 647103 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736407443 323202 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736414816 206636 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736415864 461189 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736418264 511733 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1736419176 266995 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736423308 130799 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149831&oldid=149581 5* 03UrnEn 5* (+40) 10
< 1736423402 472275 :__monty__!~toonn@user/toonn QUIT :Ping timeout: 252 seconds
< 1736424066 943366 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736424149 210716 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736424346 33255 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1736424852 375422 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Blashyrkh 5* 10New user account
> 1736425163 44531 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149832&oldid=149744 5* 03Blashyrkh 5* (+186) 10/* Introductions */
> 1736426818 638621 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Blashyrkh 5* 10uploaded "[[02File:Fire.png10]]"
> 1736427029 450578 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149834&oldid=149259 5* 03Blashyrkh 5* (+222) 10/* Programs */ Fire program uploaded
< 1736430057 988140 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736430235 217610 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736431975 707033 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03ClearLimediWater 5* 10New user account
> 1736432739 883652 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149835&oldid=149832 5* 03ClearLimediWater 5* (+207) 10
> 1736433196 329068 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 N10 02https://esolangs.org/w/index.php?oldid=149836 5* 03ClearLimediWater 5* (+21) 10Created page with ""
< 1736436979 915047 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736437597 227168 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149837&oldid=149783 5* 03AdjectiveNounNumber 5* (+12) 10
> 1736437992 211187 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149838&oldid=149837 5* 03AdjectiveNounNumber 5* (+96) 10
< 1736438200 335563 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1736439294 747677 :Everythi1g!~Everythin@static.208.206.21.65.clients.your-server.de JOIN #esolangs * :Everything
< 1736439313 576356 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1736439315 671519 :Everythi1g!~Everythin@static.208.206.21.65.clients.your-server.de QUIT :Client Quit
< 1736439334 196172 :Everything!~Everythin@static.208.206.21.65.clients.your-server.de JOIN #esolangs Everything :Everything
> 1736441879 92432 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149839&oldid=149420 5* 03TheCanon2 5* (+53) 10Added Disan Count
> 1736442673 370901 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149840&oldid=149838 5* 03AdjectiveNounNumber 5* (+463) 10
> 1736442750 982527 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149841&oldid=149839 5* 03TheCanon2 5* (+10) 10When an even number is run through Disan Count, the output doesn't include the input itself.
> 1736442886 405615 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149842&oldid=149840 5* 03AdjectiveNounNumber 5* (-32) 10
> 1736443137 667703 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149843&oldid=149828 5* 03AdjectiveNounNumber 5* (+103) 10
> 1736443283 116195 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149844&oldid=149843 5* 03AdjectiveNounNumber 5* (+6) 10
> 1736443303 373149 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149845&oldid=149844 5* 03AdjectiveNounNumber 5* (-1) 10/* -> */
< 1736443861 753085 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736443890 305327 :int-e!~noone@int-e.eu PRIVMSG #esolangs :`? procrastination
< 1736443895 968085 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :The Procrastination is destined to rule the world... right after watching this final funny cat clip on youtube.
> 1736443941 360948 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149846&oldid=149842 5* 03AdjectiveNounNumber 5* (+29) 10
> 1736444598 774060 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149847&oldid=149846 5* 03AdjectiveNounNumber 5* (+26) 10
> 1736444723 979658 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=149848&oldid=149172 5* 03TheCanon2 5* (+53) 10
< 1736445656 419277 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736445753 866169 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149849&oldid=149847 5* 03AdjectiveNounNumber 5* (+0) 10/* Syntax */
> 1736445783 614526 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149850&oldid=149849 5* 03AdjectiveNounNumber 5* (-88) 10
> 1736446072 623389 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149851&oldid=149850 5* 03AdjectiveNounNumber 5* (+191) 10
< 1736446459 859084 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736447048 93668 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736447328 391951 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736447643 678756 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736447701 127741 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1736447727 330617 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736447830 708394 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149852&oldid=149851 5* 03AdjectiveNounNumber 5* (+265) 10/* -> */
> 1736447847 339834 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149853&oldid=149852 5* 03AdjectiveNounNumber 5* (+2) 10/* Examples */
> 1736447861 478619 PRIVMSG #esolangs :14[[07Disan Count (language)14]]4 N10 02https://esolangs.org/w/index.php?oldid=149854 5* 03TheCanon2 5* (+431) 10Created page with "'''Disan Count''' is an esoteric programming language created by [[User:TheCanon2]] to demonstrate the insufficiency of using the [[Disan Count]] as a proof for Turing-completeness. ==Commands== Disan Count has 1 register and 2 commands. {|class="wikita
> 1736448365 815858 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149855&oldid=149853 5* 03AdjectiveNounNumber 5* (+202) 10/* Syntax */
> 1736448741 907139 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149856&oldid=149855 5* 03AdjectiveNounNumber 5* (+106) 10
< 1736449388 423316 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736449699 35354 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :Ping timeout: 252 seconds
< 1736449997 170880 :visilii!~visilii@188.254.110.9 JOIN #esolangs * :ZNC - https://znc.in
< 1736450000 534136 :visilii_!~visilii@188.254.110.9 QUIT :Ping timeout: 252 seconds
> 1736450083 403514 PRIVMSG #esolangs :14[[07Disan Count (language)14]]4 M10 02https://esolangs.org/w/index.php?diff=149857&oldid=149854 5* 03TheCanon2 5* (+857) 10
< 1736450919 538846 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736452090 439950 PRIVMSG #esolangs :14[[07Talk:Pistons & Pistons14]]4 10 02https://esolangs.org/w/index.php?diff=149858&oldid=79280 5* 03Jan jelo 5* (+172) 10/* Validity? */
> 1736455841 254098 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=149859&oldid=149058 5* 03Ractangle 5* (+0) 10/* Commands */
> 1736455889 226345 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=149860&oldid=149859 5* 03Ractangle 5* (+0) 10/* Examples */
< 1736456569 326549 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
> 1736458046 833382 PRIVMSG #esolangs :14[[07Talk:Convert14]]4 N10 02https://esolangs.org/w/index.php?oldid=149861 5* 03AdjectiveNounNumber 5* (+1) 10Created page with "e"
> 1736458518 387787 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149862&oldid=149773 5* 03Ractangle 5* (+1) 10/* Stuff to continue */
> 1736459555 446865 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149863&oldid=149834 5* 03Blashyrkh 5* (+64) 10/* Programs */ Add link to fire.BytePusher's source code
> 1736459628 773216 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=149864&oldid=149829 5* 03Aadenboy 5* (+188) 10/* With If */
< 1736459826 355056 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo
< 1736461421 865957 :Everything!~Everythin@static.208.206.21.65.clients.your-server.de QUIT :Quit: leaving
< 1736461857 16538 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736461889 771264 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
< 1736462229 411074 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736462612 89238 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 265 seconds
< 1736462679 337345 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :Ping timeout: 244 seconds
< 1736463365 76466 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo
< 1736464887 568270 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736466719 691997 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736467426 92662 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736467514 418088 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736468570 81440 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149865&oldid=149618 5* 03I am islptng 5* (+75) 10
< 1736472442 895580 :supercode!~supercode@user/supercode QUIT :Quit: Client closed
> 1736472557 914714 PRIVMSG #esolangs :14[[07TypeString14]]4 10 02https://esolangs.org/w/index.php?diff=149866&oldid=125431 5* 03GUAqwq 5* (-30) 10/* Turing Complete */
> 1736473683 137917 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03True-grue 5* 10New user account
> 1736474467 14803 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149867&oldid=149604 5* 03I am islptng 5* (-5653) 10Goodbye, GaoErFu!
< 1736475976 642601 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Excess Flood
< 1736475979 232312 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Remote host closed the connection
< 1736476046 69936 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
< 1736476064 434691 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736476581 429166 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 246 seconds
< 1736476590 58485 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 265 seconds
< 1736476599 397226 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736476605 415160 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
< 1736476885 496837 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736483385 120041 PRIVMSG #esolangs :14[[07Push-up automaton14]]4 N10 02https://esolangs.org/w/index.php?oldid=149868 5* 03BestCoder 5* (+52) 10Created page with "hypothetically the opposite of a push-down automaton"
> 1736483564 271551 PRIVMSG #esolangs :14[[07Category talk:Turning tarpits14]]4 10 02https://esolangs.org/w/index.php?diff=149869&oldid=138297 5* 03BestCoder 5* (+60) 10
> 1736483670 496996 PRIVMSG #esolangs :14[[07Talk:Xand14]]4 10 02https://esolangs.org/w/index.php?diff=149870&oldid=129853 5* 03BestCoder 5* (+24) 10
> 1736483684 94158 PRIVMSG #esolangs :14[[07Category:Discussion14]]4 N10 02https://esolangs.org/w/index.php?oldid=149871 5* 03BestCoder 5* (+26) 10Created page with "a category for discussions"
> 1736483699 315854 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 N10 02https://esolangs.org/w/index.php?oldid=149872 5* 03BestCoder 5* (+9) 10Created page with "recursion"
> 1736483730 198694 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149873&oldid=149872 5* 03BestCoder 5* (+24) 10
> 1736483942 9936 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 N10 02https://esolangs.org/w/index.php?oldid=149874 5* 03Aadenboy 5* (+3402) 10read! fun little idea I had
> 1736484014 943796 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=149875&oldid=149824 5* 03Aadenboy 5* (+27) 10/* anything else */ add [[User:Aadenboy/00=0|00=0]]
> 1736484118 306215 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149876&oldid=149873 5* 03Aadenboy 5* (+367) 10
> 1736487360 595086 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149877&oldid=149874 5* 03Aadenboy 5* (+86) 10fix
> 1736488137 482503 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149878&oldid=149792 5* 03Calculus is fun 5* (+93) 10Edit of intro paragraph.
> 1736488427 969347 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149879&oldid=149877 5* 03Aadenboy 5* (+91) 10
> 1736491481 381065 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149880&oldid=149878 5* 03Calculus is fun 5* (+629) 10Ackermann example
< 1736493679 529615 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736494893 74892 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736498286 951778 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736500568 494200 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736502866 486166 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736502907 85085 :fowl!~fowl@user/fowl QUIT :Quit: Ping timeout (120 seconds)
< 1736502937 170170 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
> 1736506299 318459 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 N10 02https://esolangs.org/w/index.php?oldid=149881 5* 03Calculus is fun 5* (+774) 10Created page with "Hello, I've been programming ever since I was shown Scratch in elementary school, Since then I've jumped between Java, JavaScript, WolframScript, and more, I've seen my fair share of silly programming languages, I made a small library in JS for ratio
> 1736506402 11292 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=149882&oldid=149881 5* 03Calculus is fun 5* (-24) 10
> 1736507406 907433 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=149883&oldid=149463 5* 03PrySigneToFry 5* (+247) 10
> 1736507492 446561 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149884&oldid=149713 5* 03PrySigneToFry 5* (+920) 10
> 1736507580 117971 PRIVMSG #esolangs :14[[0714]]4 N10 02https://esolangs.org/w/index.php?oldid=149885 5* 03PrySigneToFry 5* (+84) 10Created page with "{{WIP}} (yuandan) is an programming language that designed by PSTF and None1."
> 1736507641 73850 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149886&oldid=149209 5* 03PrySigneToFry 5* (+98) 10/* I've maded the page. */ new section
> 1736507652 822370 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149887&oldid=149886 5* 03PrySigneToFry 5* (-3) 10/* I've maded the page. */
> 1736508083 522733 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149888&oldid=149880 5* 03Calculus is fun 5* (+268) 10/* Behavior */
> 1736510506 810323 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149889&oldid=149885 5* 03PrySigneToFry 5* (+3667) 10
< 1736510589 568950 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 276 seconds
> 1736510681 352396 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149890&oldid=149543 5* 03PrySigneToFry 5* (+478) 10
< 1736510769 435951 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736511684 678211 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736511759 949393 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736513094 324487 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net JOIN #esolangs * :realname
< 1736513140 482077 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds
> 1736513319 827720 PRIVMSG #esolangs :14[[07Cursor14]]4 N10 02https://esolangs.org/w/index.php?oldid=149891 5* 03AdjectiveNounNumber 5* (+640) 10Created page with "Cursor is a 2-dimensional [[Esoteric programming language|esolang]] created by on Jan 10 2025 7:42 ET where you can control propertys of the cursor. (VERY WIP) {| class="wikitable" |+ Component Summarys |- ! Symbol !! Name !! Summary |- | * || Start || Start
< 1736515346 312598 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
> 1736517955 273778 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149892&oldid=149835 5* 03True-grue 5* (+141) 10true-grue introduction
> 1736517978 806578 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149893&oldid=149890 5* 03None1 5* (+395) 10/* Interpreters */
> 1736518024 669472 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=149894&oldid=149892 5* 03True-grue 5* (+29) 10
> 1736518084 469690 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03True-grue 5* 10uploaded "[[02File:Snow.png10]]"
> 1736518151 923468 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149896&oldid=149893 5* 03None1 5* (+419) 10/* Type 16 */
> 1736518600 30736 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03True-grue 5* 10uploaded "[[02File:Small snow.png10]]"
> 1736518615 616190 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149898&oldid=149889 5* 03None1 5* (+770) 10
> 1736518636 414907 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149899&oldid=149898 5* 03None1 5* (+29) 10/* Other commands */
> 1736518645 176721 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149900&oldid=149896 5* 03PrySigneToFry 5* (+2401) 10
> 1736518735 345926 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149901&oldid=149900 5* 03PrySigneToFry 5* (+17) 10
> 1736518940 54321 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149902&oldid=149863 5* 03True-grue 5* (+200) 10snowfall simulation
< 1736519321 642800 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru JOIN #esolangs * :[https://web.libera.chat] true-grue
< 1736519591 123551 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736520704 447394 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149903&oldid=149902 5* 03Blashyrkh 5* (+20) 10/* Programs */
< 1736521221 279022 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736521810 719436 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 N10 02https://esolangs.org/w/index.php?oldid=149904 5* 03Blashyrkh 5* (+75) 10Created page with "It was your article at habr.com that acquainted me with BytePusher. Thanks!"
< 1736522003 602814 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru QUIT :Quit: Client closed
< 1736522057 641215 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru JOIN #esolangs * :[https://web.libera.chat] true-grue
> 1736522366 685160 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149905&oldid=149904 5* 03True-grue 5* (+164) 10
> 1736522376 891779 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149906&oldid=149905 5* 03True-grue 5* (+1) 10
> 1736523384 707110 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149907&oldid=149906 5* 03Blashyrkh 5* (+390) 10
> 1736523421 618251 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149908&oldid=149907 5* 03Blashyrkh 5* (+4) 10
> 1736523576 940143 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149909&oldid=149908 5* 03Blashyrkh 5* (+4) 10
> 1736523806 533826 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149910&oldid=149909 5* 03True-grue 5* (+113) 10
< 1736524813 775075 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736524836 579571 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149911&oldid=149910 5* 03Blashyrkh 5* (+253) 10
> 1736524857 962151 PRIVMSG #esolangs :14[[07User:Aadenboy/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=149912&oldid=139680 5* 03Aadenboy 5* (-4807) 10test
< 1736525305 72464 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736527240 544371 PRIVMSG #esolangs :14[[07User:Aadenboy/Program states14]]4 N10 02https://esolangs.org/w/index.php?oldid=149913 5* 03Aadenboy 5* (+288) 10Created page with "mostly random ideas. zzz. == Switch-bait == A program is Switch-bait if it can: * Take an input from the user * Store the value permanently * Silently use that value within computations * Immediately change the value for something else when the use
< 1736530078 581800 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru QUIT :Quit: Client closed
> 1736531736 950784 PRIVMSG #esolangs :14[[07User:AdjectiveNounNumber14]]4 N10 02https://esolangs.org/w/index.php?oldid=149914 5* 03AdjectiveNounNumber 5* (+6) 10Created page with "ijijij"
< 1736533712 292450 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736534138 890029 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736534184 482683 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1736534250 20014 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736534315 733953 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736534371 189020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736534435 475380 PRIVMSG #esolangs :14[[07Condit14]]4 10 02https://esolangs.org/w/index.php?diff=149915&oldid=140253 5* 0347 5* (-3) 10/* Truth-machine */
> 1736534458 335463 PRIVMSG #esolangs :14[[07Condit14]]4 10 02https://esolangs.org/w/index.php?diff=149916&oldid=149915 5* 0347 5* (+0) 10/* Examples */
> 1736534787 968243 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149917&oldid=149856 5* 03AdjectiveNounNumber 5* (+27) 10
> 1736536276 118214 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149918&oldid=149730 5* 03Aadenboy 5* (+356) 10/* category removal */ new section
> 1736536459 561127 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=149919&oldid=149875 5* 03Aadenboy 5* (+56) 10
> 1736536810 901776 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02Category:Discussion10]]": undiscussed category, redundant to [[Special:AllPages/Talk:]]
> 1736536875 405966 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149920&oldid=149876 5* 03Ais523 5* (+17) 10nowiki link to deleted category (as it's important to understand the context of the page, which was not deleted because it helps to explain why the category was deleted)
> 1736536891 246065 PRIVMSG #esolangs :14[[07Talk:Xand14]]4 10 02https://esolangs.org/w/index.php?diff=149921&oldid=149870 5* 03Ais523 5* (-24) 10rm deleted category
> 1736536930 194791 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149922&oldid=149918 5* 03Ais523 5* (+269) 10/* category removal */ deleted
> 1736537739 390999 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149923&oldid=149678 5* 0347 5* (+106) 10
< 1736538273 465973 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736539772 365908 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736539912 462752 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736540910 694412 PRIVMSG #esolangs :14[[07User:Aadenboy/Program states14]]4 10 02https://esolangs.org/w/index.php?diff=149924&oldid=149913 5* 03Aadenboy 5* (-288) 10never mind! this is dumb! aagh!
< 1736541759 264969 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736541878 846102 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736542748 391270 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
< 1736542912 788137 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736546598 691591 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736547279 881790 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736547939 328019 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736548624 316969 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1736551285 116612 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736553840 428628 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 246 seconds
< 1736553950 620508 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736554039 578460 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149925&oldid=149879 5* 03Aadenboy 5* (-148) 10thanks render errors
< 1736556127 574602 :supercode!~supercode@user/supercode QUIT :Quit: Client closed
< 1736556259 221420 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 JOIN #esolangs * :realname
< 1736556420 940539 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net QUIT :Ping timeout: 252 seconds
< 1736558912 220868 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :reading my mailserver log for weird things happening, I saw an HTTP request to the SMTP submission port, which looks a bit like it might be from a search engine
< 1736558945 320316 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it looks like it followed a link to the IP+port pair
< 1736558971 209543 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and, well, anyone can put a link to any IP+port pair onto the web, but I'm vaguely surprised that someone actually did
< 1736559077 437993 :int-e!~noone@int-e.eu PRIVMSG #esolangs :hmm. search engines might pick up on something like foo.bar:123 and try HTTP requests there?
< 1736559113 218240 :int-e!~noone@int-e.eu PRIVMSG #esolangs :in these desparate times where we need every byte of training material for LLMs that we can find
< 1736559163 29293 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I don't know why anyone would even have a link to my SMTP submission port, it's not like it's usable by anyone but me
< 1736559187 620422 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :my guess is that it's on some sort of list intended for use by spammers, who don't know how many of the ports are usable (but must surely suspect that most of them aren't)
< 1736559209 718523 :int-e!~noone@int-e.eu PRIVMSG #esolangs :it could just be a weird port scan too
< 1736559233 52171 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :port scans don't usually send HTTP requests but I guess they *could*
< 1736559286 698793 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Anyway, all I have is speculation. This doesn't sound familiar in any way :)
< 1736559328 573961 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :right, it was weird enough to be worth commenting on :-)
< 1736559347 772708 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it likely isn't a problem – mailservers get so many random attacks as it is – but it's strange enough to have made me curious
< 1736559363 658489 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I get that
< 1736559404 778117 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Like... I keep looking at spam mails and wondering what the underlying scam is. Which is about equally fruitless.
< 1736559440 382052 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :in some of them, the scam appears to have been perpetrated against the sender, who has been falsely convinced by some spambot vender that the spam mail will do something useful
< 1736559461 158126 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Subject: Mail delivery failed: returning message to sender <-- meh, is that still a spam delivery vector
< 1736559474 562266 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :spam with unsubstituted placeholders is always fun, when you get a literal "$FEMALE_NAME" in the email rather than a random female name
< 1736559516 562967 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :apparently many spammers don't test their spamcannons very thoroughly
< 1736560281 640040 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I have seen TLS client hello messages on port 80 of my server
< 1736560712 235779 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :On my SMTP server, I have gotten HTTP requests, TLS client hello messages, JSON (something relating to Ethereum mining, it seems), and attempts to send messages to email addresses that do not exist on my server, and attempts at relaying messages (which are rejected by my server).
< 1736560752 398095 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Is that what "\x16\x03\x01" is? Hmm.
< 1736560792 938478 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I think "\x16\x03\x01" is the beginning of a TLS client hello message.
< 1736560824 758234 :int-e!~noone@int-e.eu PRIVMSG #esolangs :What are things like GET /.env scanning for?
< 1736560847 556865 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I don't know what that is.
< 1736561128 498026 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Huh, this one is odd too. GET /+CSCOE+/logon.html ..."CSCOE is a nonprofit organization that transforms Catholic education through innovative and entrepreneurial approaches."
< 1736561128 660753 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(scorpiond does not currently log all invalid requests, although I could change that. So, I don't know if any HTTP requests or TLS client hello messages are received on that server. Actually the specification says that TLS client hello is valid, but that servers are not required to implement it, and currently it is not implemented.)
< 1736561174 158111 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I guess that makes sense if they provide IT support (setting up web servers for schools)
< 1736561242 518334 :int-e!~noone@int-e.eu PRIVMSG #esolangs :But whatever... still the usual scans with a few fun outliers, though the .env thing was new to me.
> 1736561579 826076 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149926&oldid=149888 5* 03Calculus is fun 5* (+6) 10/* Commands */
< 1736562516 921760 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving
< 1736562586 974737 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736564227 254161 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736564713 77167 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1736564776 100494 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in
< 1736565762 746778 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1736565823 404798 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in
> 1736569286 750175 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox/My Rate to the user that I know14]]4 10 02https://esolangs.org/w/index.php?diff=149927&oldid=148893 5* 03PrySigneToFry 5* (+1) 10ZCX islptng was changed his username to I am islptng, so I had to fix the username
< 1736569984 967962 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 260 seconds
> 1736570213 38085 PRIVMSG #esolangs :14[[07Talk:Uyjhmn n14]]4 10 02https://esolangs.org/w/index.php?diff=149928&oldid=142449 5* 03PrySigneToFry 5* (+94) 10/* ? */ new section
> 1736570290 441834 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149929&oldid=149825 5* 03PrySigneToFry 5* (+13) 10
> 1736570415 999928 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149930&oldid=149901 5* 03PrySigneToFry 5* (+334) 10
< 1736571172 303066 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736571354 249105 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 N10 02https://esolangs.org/w/index.php?oldid=149931 5* 03ClearLimediWater 5* (+280) 10Created page with "'''Luke's Box Programming'''LBP[[User:ClearLimediWater]][[esoteric programming language|Esolang]] '''Luke's Box Programming''' (abbreviated as LBP) is an [[esoteric programming language]] made by [[User:ClearLimediWater]]. [[Category:Languages]]
> 1736571617 394519 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149932&oldid=149929 5* 03ClearLimediWater 5* (+42) 10
> 1736572383 38437 PRIVMSG #esolangs :14[[07Definitely unusable14]]4 M10 02https://esolangs.org/w/index.php?diff=149933&oldid=144715 5* 03PrySigneToFry 5* (+274) 10
> 1736572687 672893 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03SerialDesignationF 5* 10New user account
< 1736573408 842645 :yewscion!~yewscion@172.59.136.21 JOIN #esolangs yewscion :Claire Rodriguez
< 1736573483 101587 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736573684 461899 :yewscion!~yewscion@172.59.136.21 QUIT :Ping timeout: 252 seconds
> 1736573693 163834 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149934&oldid=149899 5* 03PrySigneToFry 5* (+436) 10
< 1736576372 173686 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1736578309 530039 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Edward Z 5* 10New user account
> 1736578438 575421 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149935&oldid=149894 5* 03Edward Z 5* (+69) 10
> 1736578636 198461 PRIVMSG #esolangs :14[[07Starry14]]4 10 02https://esolangs.org/w/index.php?diff=149936&oldid=38232 5* 03Edward Z 5* (+2311) 10
< 1736579381 184587 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 QUIT :Ping timeout: 252 seconds
< 1736579908 132531 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736580798 358291 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
> 1736582459 947225 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149937&oldid=149923 5* 0347 5* (+4) 10/* Syntax */
< 1736582654 803348 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736584893 835945 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736586888 83442 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736589166 548901 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736589655 736283 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736590131 415875 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 N10 02https://esolangs.org/w/index.php?oldid=149938 5* 03PrySigneToFry 5* (+39) 10Created page with ""
> 1736590328 569692 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149939&oldid=149597 5* 03PrySigneToFry 5* (+56) 10
> 1736590640 878328 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149940&oldid=149729 5* 03PrySigneToFry 5* (+1537) 10
> 1736590849 254936 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149941&oldid=149940 5* 03PrySigneToFry 5* (+214) 10
> 1736591047 374775 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=149942&oldid=148122 5* 03PrySigneToFry 5* (+978) 10/* Check out my(and None1's) Esolang! */ new section
> 1736591777 469810 PRIVMSG #esolangs :14[[07Permission denied14]]4 10 02https://esolangs.org/w/index.php?diff=149943&oldid=142922 5* 03PrySigneToFry 5* (+553) 10
> 1736593237 558000 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149944&oldid=149884 5* 03I am islptng 5* (+1191) 10
< 1736596971 270717 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1736597127 720227 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736597605 724428 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736598006 1242 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736598170 372214 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1736598216 980715 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :hi
< 1736598964 651181 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736599106 746762 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736599258 677651 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149945&oldid=149938 5* 03ClearLimediWater 5* (+116) 10
> 1736599382 287134 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=149946&oldid=149931 5* 03ClearLimediWater 5* (-49) 10
> 1736599425 566213 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149947&oldid=149945 5* 03ClearLimediWater 5* (+6) 10
> 1736599838 862830 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149948&oldid=149836 5* 03ClearLimediWater 5* (+124) 10
< 1736599890 187884 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 JOIN #esolangs * :realname
< 1736599893 769742 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 QUIT :Remote host closed the connection
< 1736599947 130120 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736600550 661325 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149949&oldid=149947 5* 03ClearLimediWater 5* (+143) 10
< 1736600611 263142 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
> 1736600704 828584 PRIVMSG #esolangs :14[[07WaifuScript14]]4 N10 02https://esolangs.org/w/index.php?oldid=149950 5* 03Juanp32 5* (+1158) 10made this esolang to troll my cs teacher lol
> 1736600875 751805 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=149951&oldid=149711 5* 03Juanp32 5* (+78) 10/* General languages */
> 1736600959 4191 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149952&oldid=149593 5* 03Juanp32 5* (+52) 10/* languages i made, i guess */
< 1736601053 693766 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1736601161 223572 PRIVMSG #esolangs :14[[07WaifuScript14]]4 M10 02https://esolangs.org/w/index.php?diff=149953&oldid=149950 5* 03Juanp32 5* (-1) 10tyop
> 1736601454 383183 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ClearLimediWater 5* 10uploaded "[[02File:Wankong497 01.jpg10]]": CLW
< 1736601485 327197 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736601975 71785 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149955&oldid=149948 5* 03ClearLimediWater 5* (+241) 10
> 1736602337 959159 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 M10 02https://esolangs.org/w/index.php?diff=149956&oldid=149955 5* 03ClearLimediWater 5* (+93) 10
< 1736602421 358454 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736603646 641551 :Guest75!~Guest75@2a02:6b67:d4b0:5e00:adaa:cb6a:5ede:ba4d JOIN #esolangs * :[https://web.libera.chat] Guest75
< 1736603674 361965 :Guest75!~Guest75@2a02:6b67:d4b0:5e00:adaa:cb6a:5ede:ba4d QUIT :Client Quit
> 1736603691 526833 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=149957&oldid=149946 5* 03ClearLimediWater 5* (+1274) 10
< 1736604003 692439 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1736604031 41084 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149958&oldid=149841 5* 03TheCanon2 5* (+74) 10grammar
< 1736604238 928512 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736605008 365410 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736605109 719064 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736605113 276524 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736606784 37608 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149959&oldid=149939 5* 0347 5* (-56) 10pstf shut up
> 1736606859 659069 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149960&oldid=149941 5* 0347 5* (-1751) 10and?
> 1736606884 64374 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149961&oldid=149960 5* 0347 5* (+1537) 10
< 1736608009 948648 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736609593 68486 :supercode!~supercode@user/supercode QUIT :Quit: Client closed
> 1736610286 979398 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ZachChecksOutEsolangs 5* 10uploaded "[[02File:Factorial Program.png10]]"
> 1736610312 360778 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149963&oldid=144775 5* 03ZachChecksOutEsolangs 5* (+67) 10
> 1736610341 652031 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149964&oldid=149963 5* 03ZachChecksOutEsolangs 5* (+0) 10
> 1736610367 803019 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149965&oldid=149964 5* 03ZachChecksOutEsolangs 5* (+0) 10
> 1736610386 148997 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149966&oldid=149965 5* 03ZachChecksOutEsolangs 5* (+0) 10
< 1736610394 135159 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
> 1736610466 520432 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149967&oldid=149966 5* 03ZachChecksOutEsolangs 5* (+116) 10
< 1736611098 329850 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
< 1736611198 525374 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736612833 842126 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736614373 473921 PRIVMSG #esolangs :14[[07WaidWmy14]]4 10 02https://esolangs.org/w/index.php?diff=149968&oldid=146980 5* 03AlmostGalactic 5* (+557) 10
< 1736616406 240036 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736616960 439069 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736617280 185496 PRIVMSG #esolangs :14[[07GotoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149969&oldid=119909 5* 03Quito0567 5* (+1) 10
< 1736620570 472501 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736620630 15756 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 260 seconds
< 1736620653 732383 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736620748 82212 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736620833 436396 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736622109 349007 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 N10 02https://esolangs.org/w/index.php?oldid=149970 5* 03Tommyaweosme 5* (+1100) 10Created page with " - Paliraworld.kgm - Paliraworld.kgm 2016-2021 -Paliraworld.kgm Paliraworld.kgm Paliraworld.kgm ..."
> 1736622149 717979 PRIVMSG #esolangs :14[[07Translated /PSTF Again214]]4 10 02https://esolangs.org/w/index.php?diff=149971&oldid=146375 5* 03Tommyaweosme 5* (+66) 10
< 1736622408 712930 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736623577 994430 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736624742 361025 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalsia10]] to [[Switch gr]]
> 1736624804 500443 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149974&oldid=149972 5* 0347 5* (+71) 10
> 1736624976 523959 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149975&oldid=149974 5* 0347 5* (-146) 10
> 1736625217 338990 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:Off default.png10]]"
> 1736625341 97732 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:On default.png10]]"
> 1736625434 677994 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:Off alt.png10]]"
> 1736625493 147472 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149979&oldid=149975 5* 0347 5* (+199) 10/* Swiches */
> 1736625506 837041 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:On alt.png10]]"
> 1736625598 920309 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149981&oldid=149979 5* 0347 5* (-3) 10
> 1736625628 578612 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149982&oldid=149981 5* 0347 5* (+3) 10
> 1736625922 728937 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149983&oldid=149982 5* 0347 5* (+114) 10
< 1736626271 137656 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736626594 601020 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149984&oldid=149862 5* 03Ractangle 5* (+1) 10/* Stuff to continue */
> 1736626616 697849 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149985&oldid=149984 5* 03Ractangle 5* (-12) 10/* Stuff to continue */
> 1736626681 183539 PRIVMSG #esolangs :14[[07Hum14]]4 10 02https://esolangs.org/w/index.php?diff=149986&oldid=149095 5* 03Ractangle 5* (-868) 10Redirected page to [[Jive]]
> 1736626701 204475 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149987&oldid=149677 5* 03Ractangle 5* (-10) 10/* Esolangs */
> 1736627049 301898 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149988&oldid=144802 5* 03Ractangle 5* (-110) 10/* Syntax */
> 1736627145 285516 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149989&oldid=149988 5* 03Ractangle 5* (+1) 10/* Hello, world! */
> 1736627391 999266 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149990&oldid=149989 5* 03Ractangle 5* (+0) 10/* Interpreter */
> 1736627404 14851 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Ractangle 5* 10moved [[02JAGL10]] to [[Just]]
> 1736627504 619240 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149993&oldid=149991 5* 03Ractangle 5* (+39) 10
< 1736627737 745793 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736627908 39293 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149994&oldid=149993 5* 03Ractangle 5* (+0) 10/* Interpreter */
< 1736627950 683000 :supercode!~supercode@user/supercode QUIT :Ping timeout: 240 seconds
> 1736627952 610385 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149995&oldid=149985 5* 03Ractangle 5* (+0) 10/* Stuff to continue */
< 1736627963 228750 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
> 1736628024 994343 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149996&oldid=149994 5* 03Ractangle 5* (-99) 10/* Syntax */
< 1736628048 761053 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1736628057 865641 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736628145 393348 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149997&oldid=149996 5* 03Ractangle 5* (+43) 10
< 1736628201 709123 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736628215 989279 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149998&oldid=149997 5* 03Ractangle 5* (+16) 10/* Syntax */
> 1736628940 680847 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149999&oldid=149998 5* 03Ractangle 5* (+16) 10/* Syntax */
> 1736628984 196976 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150000&oldid=149999 5* 03Ractangle 5* (+29) 10/* Examples */
< 1736629983 974632 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1736630063 899149 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1736630454 935059 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150001&oldid=143785 5* 03Ractangle 5* (-14) 10/* Commands */
> 1736630715 524154 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Ractangle 5* 10uploaded a new version of "[[02File: logo.png10]]"
< 1736631037 551527 :supercode!~supercode@user/supercode QUIT :Quit: Client closed
< 1736631494 718219 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736631695 876426 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736631954 3201 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150003&oldid=145268 5* 03Ractangle 5* (+4) 10Changed redirect target from [[User:Ractangle/Sandbox#Rating and people]] to [[User:Ractangle/Sandbox#Opinions about people]]
< 1736632872 416995 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
> 1736633122 646724 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150004&oldid=150003 5* 03Ais523 5* (+192) 10rv edit of a page about an esolang to redirect to a userspace page that isn't an esolang that isn't an appropriate use for mainspace
> 1736633403 932659 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150005&oldid=149348 5* 03Ais523 5* (+849) 10/* Please stop breaking mainspace links by moving pages */ new section
< 1736633488 830087 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh no, this is going to be a huge mess to sort out
< 1736633514 589884 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :https://esolangs.org/wiki/Special:Log?type=move&user=Ractangle for anyone who is wondering about the mess
< 1736633792 204645 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736636128 255088 PRIVMSG #esolangs :14[[07Braine14]]4 10 02https://esolangs.org/w/index.php?diff=150006&oldid=68175 5* 03Kaveh Yousefi 5* (+289) 10Rectified the memory description from the bit to the byte type, extended the instructions elucidation by the line numbering concept, and supplemented a page category tag.
< 1736636144 643608 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1736636276 668308 PRIVMSG #esolangs :14[[07Braine14]]4 10 02https://esolangs.org/w/index.php?diff=150007&oldid=150006 5* 03Kaveh Yousefi 5* (+491) 10Introduced an examples section comprehending one inicipial member, added a hyperlink to my implementation on GitHub, and supplemented the Implemented category tag.
< 1736636600 8284 :shmup!~shmup@dev.host QUIT :Remote host closed the connection
> 1736636798 751004 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=150008&oldid=149431 5* 03Jan jelo 5* (+27) 10/* Quine */
> 1736638157 374973 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=150009&oldid=149742 5* 03Ais523 5* (+180) 10/* 2009 */ make a modern-syntax version of jix_wiggle3 so that it can be tested against today's hills
< 1736638326 665978 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Gregor_sucralose_philip: points -1.00, score 17.83, rank 24/47
< 1736638349 690479 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :that one scores shockingly well for a program from 2011
< 1736638652 101288 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it seems to be primarily due to programs that simply can't deal with the opponent using a forward decoy setup
< 1736638819 410298 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Lymia_nyuroki2: points 10.21, score 30.22, rank 6/47
< 1736638858 205391 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and that one is stronger than nyuroki3, which may have been overfitted
< 1736640184 415508 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1736640333 226746 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736643184 667154 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150010&oldid=149944 5* 03PrySigneToFry 5* (+845) 10
> 1736643201 538949 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150011&oldid=150010 5* 03PrySigneToFry 5* (+0) 10Fixed time
< 1736643413 109533 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
> 1736643717 549971 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=150012&oldid=149961 5* 03PrySigneToFry 5* (+773) 10
> 1736644107 518587 PRIVMSG #esolangs :14[[07Nope.14]]4 M10 02https://esolangs.org/w/index.php?diff=150013&oldid=148992 5* 03PrySigneToFry 5* (+242) 10
> 1736644359 963303 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150014&oldid=149934 5* 03PrySigneToFry 5* (+81) 10
> 1736644598 907793 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150015&oldid=149970 5* 03PrySigneToFry 5* (+48) 10
> 1736645119 134981 PRIVMSG #esolangs :14[[07Translated /PSTF Again314]]4 N10 02https://esolangs.org/w/index.php?oldid=150016 5* 03PrySigneToFry 5* (+1924) 10Created page with "[[Translated /tommyaweosme]] is not crazy enough, so let's be crazier!!!!!! 1. Drag out that scarred program - .kgm - .kgm 2016-2021 - ..."
> 1736646135 501060 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150017&oldid=149930 5* 03PrySigneToFry 5* (+423) 10
< 1736646500 410813 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736646794 504490 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150018&oldid=149956 5* 03ClearLimediWater 5* (+27) 10
> 1736647064 401247 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=150019&oldid=149957 5* 03ClearLimediWater 5* (+110) 10
> 1736647169 897387 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 N10 02https://esolangs.org/w/index.php?oldid=150020 5* 03ClearLimediWater 5* (+753) 10Created page with "'''Luke's Box Pseudocode''' (abbreviated as LBP2) is an ''not very'' [[esoteric programming language]] made by [[User:ClearLimediWater]]. == Introduction == This is a simplified version of LBP1. == Examples == === [[Hello, world!]] === FUNC{
< 1736647356 109630 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving
< 1736647364 162745 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Quit: iovoid has quit!
< 1736647364 200145 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Read error: Connection reset by peer
< 1736651103 891828 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1736651134 135770 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
> 1736653015 993554 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150021&oldid=150020 5* 03ClearLimediWater 5* (-250) 10/* Hello, world! */
> 1736653389 273167 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150022&oldid=149949 5* 03ClearLimediWater 5* (+133) 10
< 1736653397 53074 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
> 1736653452 762185 PRIVMSG #esolangs :14[[07User:Tommyaweosme/BRING BACK THE OLD SANDBOX14]]4 10 02https://esolangs.org/w/index.php?diff=150023&oldid=149442 5* 03PrySigneToFry 5* (+14) 10fixed
< 1736653511 991801 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736653624 70147 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
< 1736655655 250548 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving
< 1736655659 132928 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Quit: Blame iczero something happened
< 1736655659 171193 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Quit: iovoid has quit!
> 1736655845 493937 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150024&oldid=150019 5* 03ClearLimediWater 5* (-6) 10/* Commands */
< 1736655960 183119 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736656075 68862 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736656178 190894 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
> 1736662214 755703 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150025&oldid=150021 5* 03ClearLimediWater 5* (+33) 10
< 1736662815 657112 :Guest2!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736662848 797391 :Guest2!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736662877 639684 :Guest71!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736662889 368473 :Guest71!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736662903 640596 :Guest31!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736663039 91056 :Guest31!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736663650 675460 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736663676 722282 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
< 1736664181 349613 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736665214 325963 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150026&oldid=150005 5* 03Ractangle 5* (+172) 10/* Please stop breaking mainspace links by moving pages */
> 1736665268 187936 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150027&oldid=150004 5* 03Ractangle 5* (-178) 10
> 1736665340 433033 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150028&oldid=150027 5* 03Ractangle 5* (+7) 10
< 1736668833 119102 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736671013 233658 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Vertical Tab 'N 5* 10New user account
> 1736671062 857980 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150029&oldid=149935 5* 03Vertical Tab 'N 5* (+152) 10
> 1736671235 663822 PRIVMSG #esolangs :14[[07User:Vertical tab 'N14]]4 N10 02https://esolangs.org/w/index.php?oldid=150030 5* 03Vertical Tab 'N 5* (+1051) 10I temporarily stored this in another wiki's sandbox.
< 1736671599 310183 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736671684 435653 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736672107 286734 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736672258 232621 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736672452 169853 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150031&oldid=150000 5* 03Ractangle 5* (-3) 10
> 1736674143 656797 PRIVMSG #esolangs :14[[07Snakel/Compatibility methods14]]4 10 02https://esolangs.org/w/index.php?diff=150032&oldid=147836 5* 03Ractangle 5* (+13) 10/* Ultium */
> 1736678480 598593 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox/Some useless code14]]4 N10 02https://esolangs.org/w/index.php?oldid=150033 5* 03PrySigneToFry 5* (+1752) 10Created page with "= C/C++ = == Wouldn't it be better to just comment it out? == while(false) { // TODO } if(false) { // TODO } == It'll definitely execute == #include --snip-- if(1 == 1) { if
> 1736678515 895233 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150034&oldid=141723 5* 03PrySigneToFry 5* (+95) 10
> 1736678541 820699 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150035&oldid=150034 5* 03PrySigneToFry 5* (-26) 10
> 1736678834 12884 PRIVMSG #esolangs :14[[07Anti-Plushie language/PSTF14]]4 10 02https://esolangs.org/w/index.php?diff=150036&oldid=149461 5* 03PrySigneToFry 5* (+37) 10
> 1736679154 190658 PRIVMSG #esolangs :14[[07+14]]4 10 02https://esolangs.org/w/index.php?diff=150037&oldid=149460 5* 03PrySigneToFry 5* (+158) 10
< 1736680078 337174 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
< 1736681525 951719 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736683420 505109 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736683544 428378 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736684542 562792 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150038&oldid=150015 5* 03I am islptng 5* (+49) 10
> 1736684555 822692 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150039&oldid=150038 5* 03I am islptng 5* (-1) 10
> 1736684645 513680 PRIVMSG #esolangs :14[[07Translated /PSTF Again314]]4 10 02https://esolangs.org/w/index.php?diff=150040&oldid=150016 5* 03I am islptng 5* (+87) 10
< 1736684720 371878 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736685244 590676 PRIVMSG #esolangs :14[[07Translated /islptng Again 214]]4 N10 02https://esolangs.org/w/index.php?oldid=150041 5* 03I am islptng 5* (+1892) 10Created page with "1.Take that [[Translated /PSTF Again3|]]. Macintosh Macintosh ..."
< 1736686165 4343 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736687096 731098 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox/Titin14]]4 N10 02https://esolangs.org/w/index.php?oldid=150042 5* 03I am islptng 5* (+21166) 10Created page with " mttgaptftgplgsvvvluystatfuahisyfpvpuvsrfndygviststlpyvgisfsdynakltipavtkaqsynoslkatqysygatstaullvkautappqfvgnlgsmtvngysgvnlgvnvtyipqpvvkfondyauigssldfgisguydloslliauaopudsytosvqatqsvynatstaullvgyuuuvpakktktivstagisusngtniukkiuahfdansi
> 1736687183 131556 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox/Titin14]]4 10 02https://esolangs.org/w/index.php?diff=150043&oldid=150042 5* 03I am islptng 5* (+379) 10
< 1736687968 259977 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736688736 238384 PRIVMSG #esolangs :14[[07Titin14]]4 N10 02https://esolangs.org/w/index.php?oldid=150044 5* 03I am islptng 5* (+42147) 10Created page with "{{wrongtitle|title=Methionylthreonylthreonylalanylprolyl...leucylarginylthreonylserylvalylis}}
This is a trivial [[brainstack(islptng)|brainstack]] substitution. ==Syntax== Every program starts with the first 9999 letters of titin: methionylthreonylthreonylgl
> 1736688815 54698 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=150045&oldid=149865 5* 03I am islptng 5* (+59) 10
< 1736690569 147354 :supercode!~supercode@user/supercode QUIT :Quit: Client closed
< 1736690742 715142 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736691440 928280 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736692017 908837 PRIVMSG #esolangs :14[[07Translated /islptng Again 214]]4 10 02https://esolangs.org/w/index.php?diff=150046&oldid=150041 5* 03MihaiEso 5* (+46) 10
< 1736692921 221165 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1736692975 414389 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150047&oldid=150014 5* 03PrySigneToFry 5* (+301) 10
> 1736693167 535559 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 N10 02https://esolangs.org/w/index.php?oldid=150048 5* 03MihaiEso 5* (+2718) 10Created page with "1.Take that [[Translated /islptng Again 2|]]. 75 De Feed Nutrition Tokuho 2. Mix well with 2500000 bags of instant noodles, 100000 liters of Coca-Cola, 100000..."
> 1736693579 478199 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150049&oldid=150047 5* 03PrySigneToFry 5* (+1163) 10
> 1736693820 289236 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150050&oldid=150049 5* 03PrySigneToFry 5* (+226) 10
< 1736694126 712218 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736696114 16785 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736696262 759891 PRIVMSG #esolangs :14[[07Talk:Translated /Mihai Again!14]]4 N10 02https://esolangs.org/w/index.php?oldid=150051 5* 03I am islptng 5* (+957) 10Created page with "100000 liters of liquid nitrogen at -999999999999 degrees Celsius
Fun fact: Nitrogen at -273.15 degree Celsius (or below) is solid. Also, everybody actually can't freeze something to -273.16 degree Celsius. 1736697572 98308 PRIVMSG #esolangs :14[[07Talk:14]]4 N10 02https://esolangs.org/w/index.php?oldid=150052 5* 03I am islptng 5* (+604) 10Created page with "How to use library Kitten4? By the way I'm still a fan of Kitten4. ~~~~"
< 1736698154 215204 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736698202 649709 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736699681 33120 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736699761 718728 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736699776 963803 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736702596 714426 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=150053&oldid=150012 5* 03Juanp32 5* (+137) 10
> 1736703133 665121 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Titin10]] to [[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]]
> 1736703173 260191 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move_redir10 02 5* 0347 5* 10moved [[02Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh10]] to [[Titin]] over redirect: Revert
> 1736703173 283483 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete_redir10 02 5* 0347 5* 1047 deleted redirect [[02Titin10]] by overwriting: Deleted to make way for move from "[[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]]"
> 1736703567 277175 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150058&oldid=150031 5* 0347 5* (-32) 10/* Syntax */
> 1736703574 35046 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150059&oldid=150058 5* 0347 5* (-3) 10/* Cat program */
< 1736705450 106134 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736706939 876229 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736707006 193536 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736707035 450896 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 246 seconds
< 1736707104 676304 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736707184 38104 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736707258 795220 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736707359 972246 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :
< 1736707363 720386 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736707443 6425 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1736707572 800873 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736708074 138703 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
< 1736708581 158290 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736708725 171382 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 248 seconds
< 1736711092 38325 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736711728 672756 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736712367 376860 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736712465 818499 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736713030 643230 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Ping timeout: 240 seconds
< 1736713240 577598 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736713568 440525 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736714622 927622 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
> 1736715926 552694 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03FluixMakesEsolangs 5* 10New user account
< 1736716031 605247 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736716137 669483 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=150060&oldid=150029 5* 03FluixMakesEsolangs 5* (+129) 10/* Introductions */
< 1736716200 903369 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736718318 501810 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Remote host closed the connection
< 1736718395 472539 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736720649 190165 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736721631 576583 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736724047 67938 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds
> 1736724584 943777 PRIVMSG #esolangs :14[[07User:Jan jelo/Lambda to SKI14]]4 N10 02https://esolangs.org/w/index.php?oldid=150061 5* 03Jan jelo 5* (+1559) 10Created page with "This is a converter in Haskell converts lambda calculus into SKI combinators. main = do print $ convert $ omega -- ((s i) i) print $ convert $ turing -- (((s i) i) ((s (k (s i))) ((s ((s (k s)) ((s (k k)) ((s i) i)))) (k i
> 1736724771 982971 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150062&oldid=149583 5* 03Jan jelo 5* (+33) 10/* Other */
< 1736725506 95486 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736725747 804472 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150063&oldid=150048 5* 03I am islptng 5* (+12) 10fix
< 1736726628 67785 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736726825 95369 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736727731 707517 :voxpelli!sid31634@id-31634.tinside.irccloud.com JOIN #esolangs voxpelli :Pelle Wessman
> 1736728194 620916 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 M10 02https://esolangs.org/w/index.php?diff=150064&oldid=147835 5* 03Calculus is fun 5* (+90) 10Added MoreMathRPN example
> 1736728740 570247 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150065&oldid=149700 5* 03PkmnQ 5* (+522) 10/* Examples */
< 1736728743 675185 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736728764 166249 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150066&oldid=150065 5* 03PkmnQ 5* (+1) 10/* > */ Fish
> 1736728866 851507 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150067&oldid=150066 5* 03PkmnQ 5* (+4) 10/* Fish */
< 1736728948 362993 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736729013 207208 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=150068&oldid=149848 5* 03TheCanon2 5* (+62) 10
> 1736729991 878303 PRIVMSG #esolangs :14[[07Looping counter14]]4 M10 02https://esolangs.org/w/index.php?diff=150069&oldid=149215 5* 03Calculus is fun 5* (+84) 10Added MoreMathRPN example
> 1736732250 629084 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 N10 02https://esolangs.org/w/index.php?oldid=150070 5* 03TheCanon2 5* (+788) 10Created page with "In the video [https://www.youtube.com/watch?v=QyzNsOhshis| "We Built A Computer in Mario Maker!"], the Game Theorists describe a machine made in Mario Maker that uses logic gates to add two numbers from 0-7 and prints the result as
> 1736732736 467703 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150071&oldid=150024 5* 03ClearLimediWater 5* (+0) 10/* Commands */
> 1736732751 808498 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150072&oldid=147690 5* 03BestCoder 5* (+102) 10
> 1736732874 359208 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150073&oldid=150071 5* 03ClearLimediWater 5* (+0) 10/* Commands */
< 1736732928 698936 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736733320 877635 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150074&oldid=150025 5* 03ClearLimediWater 5* (+386) 10/* Hello, world! */
> 1736733567 151181 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150075&oldid=135613 5* 03Calculus is fun 5* (+526) 10Added MoreMathRPN example
> 1736733604 603789 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150076&oldid=150075 5* 03Calculus is fun 5* (-3) 10/* MoreMathRPN */
> 1736733647 71867 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150077&oldid=150076 5* 03Calculus is fun 5* (-2) 10/* MoreMathRPN */
> 1736734163 895628 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150078&oldid=150074 5* 03ClearLimediWater 5* (+129) 10/* A+B Problem */
> 1736734199 256592 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150079&oldid=150073 5* 03ClearLimediWater 5* (-1) 10/* Commands */
> 1736734589 235154 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150080&oldid=150078 5* 03ClearLimediWater 5* (+260) 10/* Truth-machine */
> 1736734603 731785 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 M10 02https://esolangs.org/w/index.php?diff=150081&oldid=150070 5* 03TheCanon2 5* (+312) 10
> 1736736091 315295 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150082&oldid=134890 5* 03Calculus is fun 5* (+250) 10Added MoreMathRPN example
> 1736736112 374729 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 M10 02https://esolangs.org/w/index.php?diff=150083&oldid=150080 5* 03ClearLimediWater 5* (+45) 10/* Examples */
< 1736736568 946096 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736738362 639322 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150084&oldid=149470 5* 03Calculus is fun 5* (+82) 10Added MoreMathRPN example
> 1736740107 509956 PRIVMSG #esolangs :14[[07Never Gonna Give You Up14]]4 M10 02https://esolangs.org/w/index.php?diff=150085&oldid=145237 5* 03Calculus is fun 5* (+1184) 10Added MoreMathRPN example
> 1736740113 141420 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 M10 02https://esolangs.org/w/index.php?diff=150086&oldid=150081 5* 03TheCanon2 5* (+969) 10finished
< 1736742131 996775 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736742155 15533 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1736744322 449094 PRIVMSG #esolangs :14[[07$3COND14]]4 10 02https://esolangs.org/w/index.php?diff=150087&oldid=103153 5* 03BoundedBeans 5* (-1) 10Fix typo of "an"
> 1736744879 542215 PRIVMSG #esolangs :14[[07Drive-In Window JSON14]]4 10 02https://esolangs.org/w/index.php?diff=150088&oldid=129924 5* 03BoundedBeans 5* (+1) 10The backtick is reserved in namespaced IDs if it needs to be escaped
> 1736745007 942438 PRIVMSG #esolangs :14[[07Drive-In Window JSON14]]4 10 02https://esolangs.org/w/index.php?diff=150089&oldid=150088 5* 03BoundedBeans 5* (-41) 10Fix some reserved character stuff
< 1736747842 151805 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736747885 363322 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1736750890 228395 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=150090&oldid=150084 5* 03Ractangle 5* (-1) 10/* Implementations */
< 1736751629 143929 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736753118 236092 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1736753502 144490 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Evening.
< 1736755098 636285 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736756445 630776 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1736757146 618719 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150091&oldid=150072 5* 03Ractangle 5* (+204) 10/* UHH */
< 1736762877 129645 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736763927 962016 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150092&oldid=150091 5* 03PkmnQ 5* (+234) 10
> 1736767316 2093 PRIVMSG #esolangs :14[[07CreativeASM14]]4 10 02https://esolangs.org/w/index.php?diff=150093&oldid=148709 5* 03MihaiEso 5* (-191) 10
> 1736767331 240501 PRIVMSG #esolangs :14[[07CreativeASM14]]4 10 02https://esolangs.org/w/index.php?diff=150094&oldid=150093 5* 03MihaiEso 5* (-23) 10
> 1736767520 902483 PRIVMSG #esolangs :14[[07CreativeASM/Assembler/Old Versions14]]4 10 02https://esolangs.org/w/index.php?diff=150095&oldid=136136 5* 03MihaiEso 5* (+8) 10
> 1736769426 882319 PRIVMSG #esolangs :14[[07CreativeASM/Examples14]]4 10 02https://esolangs.org/w/index.php?diff=150096&oldid=136138 5* 03MihaiEso 5* (+5671) 10
> 1736769491 396502 PRIVMSG #esolangs :14[[07Never Gonna Give You Up14]]4 10 02https://esolangs.org/w/index.php?diff=150097&oldid=150085 5* 03MihaiEso 5* (+73) 10
> 1736769579 513599 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150098&oldid=149932 5* 03Buckets 5* (+12) 10
> 1736769587 24866 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150099&oldid=150022 5* 03ClearLimediWater 5* (+118) 10
> 1736769680 576517 PRIVMSG #esolangs :14[[07Chops14]]4 N10 02https://esolangs.org/w/index.php?oldid=150100 5* 03Buckets 5* (+2454) 10Created page with "Chops is an esoteric language where it's instructions are variable, dependent on the previous ASCII character created by [[User:Buckets]], created to fill the purpose of "What if I just made an esolang, so that It's hard enough to look like garbage, but easy to make a mac
< 1736769813 135044 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736770001 814517 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736772163 457002 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736775992 217444 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736776222 377039 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs * :Claire Rodriguez
< 1736776392 98171 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 265 seconds
> 1736778989 657603 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150101&oldid=150069 5* 03Jan jelo 5* (+203) 10/* Unlambda */
> 1736779061 83280 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150102&oldid=150101 5* 03Jan jelo 5* (-1) 10/* Unlambda */
> 1736779477 918375 PRIVMSG #esolangs :14[[07Unlambda14]]4 10 02https://esolangs.org/w/index.php?diff=150103&oldid=147426 5* 03Jan jelo 5* (+244) 10/* Examples */
< 1736779936 613669 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736781344 280520 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=150104&oldid=149903 5* 03Blashyrkh 5* (+238) 10/* Programs */
> 1736782101 109936 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=150105&oldid=150104 5* 03Blashyrkh 5* (-27) 10/* Programs */
< 1736782243 275036 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 252 seconds
< 1736782243 311592 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 252 seconds
< 1736782250 53904 :moony!moony@hellomouse/dev/moony QUIT :Ping timeout: 265 seconds
< 1736783016 677139 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736783303 499008 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736783343 433292 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736783386 424729 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736783406 677468 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736783416 217796 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736783918 521787 :molson!~molson@2605-4A80-2101-99D0-6F3C-C8E-3717-10C4-dynamic.midco.net JOIN #esolangs molson :realname
< 1736784097 397952 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736784115 2902 :molson_!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 QUIT :Ping timeout: 260 seconds
> 1736786135 540597 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150106&oldid=147179 5* 03Calculus is fun 5* (+431) 10Added MoreMathRPN example
< 1736787369 928053 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736787423 411550 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736787522 280419 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150107&oldid=149926 5* 03Calculus is fun 5* (+369) 10Added links of examples on other pages
> 1736788920 495364 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150108&oldid=150082 5* 03Blashyrkh 5* (+2263) 10/* Examples */ FizzBuzz implementation in Lazy K
< 1736790513 883580 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736792011 304731 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736792604 659502 PRIVMSG #esolangs :14[[07Curse14]]4 M10 02https://esolangs.org/w/index.php?diff=150109&oldid=69669 5* 03Jan jelo 5* (+28) 10/* Bijective Pair Function */
< 1736793470 912729 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736793473 54647 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 265 seconds
< 1736793552 561785 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736794082 738220 PRIVMSG #esolangs :14[[07202514]]4 10 02https://esolangs.org/w/index.php?diff=150110&oldid=130286 5* 0347 5* (+0) 10/* Interpreter */
> 1736794277 670582 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150111&oldid=150090 5* 03Calculus is fun 5* (+0) 10/* External resources */
> 1736796750 63733 PRIVMSG #esolangs :14[[07Half hearted14]]4 N10 02https://esolangs.org/w/index.php?oldid=150112 5* 03Calculus is fun 5* (+1050) 10Added Half hearted program form
< 1736799414 633952 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 244 seconds
< 1736799766 823472 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1736806045 349680 PRIVMSG #esolangs :14[[07AGG14]]4 10 02https://esolangs.org/w/index.php?diff=150113&oldid=122949 5* 03Mmph 5* (+81) 10
> 1736806168 984849 PRIVMSG #esolangs :14[[07AGG14]]4 M10 02https://esolangs.org/w/index.php?diff=150114&oldid=150113 5* 03Mmph 5* (+32) 10
> 1736806242 762631 PRIVMSG #esolangs :14[[07User:Brain Boy 5314]]4 M10 02https://esolangs.org/w/index.php?diff=150115&oldid=130540 5* 03Brain Boy 53 5* (+27) 10
< 1736806451 831826 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736806720 740661 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736806814 226751 PRIVMSG #esolangs :14[[07NoError14]]4 10 02https://esolangs.org/w/index.php?diff=150116&oldid=132109 5* 03Brain Boy 53 5* (+1) 10
> 1736807256 54558 PRIVMSG #esolangs :14[[07Malbolge Reborn14]]4 10 02https://esolangs.org/w/index.php?diff=150117&oldid=131441 5* 03Brain Boy 53 5* (+18) 10
< 1736807765 807790 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736808767 109428 PRIVMSG #esolangs :14[[07Malbolge Reborn14]]4 M10 02https://esolangs.org/w/index.php?diff=150118&oldid=150117 5* 03Brain Boy 53 5* (+36) 10
> 1736809487 493902 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03WinslowJosiah 5* 10New user account
< 1736809986 36222 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736812306 679679 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736812978 34819 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736813171 130997 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736814506 747735 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736814551 330691 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736818468 678743 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736818964 502618 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 260 seconds
< 1736818974 991369 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 260 seconds
< 1736820022 977323 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736820028 984533 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736821251 915415 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736821704 458497 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736822387 307199 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736822875 459594 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736824201 564043 :Sgeo!~Sgeo@user/sgeo QUIT :*.net *.split
< 1736824202 493417 :op_4!~tslil@user/op-4/x-9116473 QUIT :*.net *.split
< 1736824202 923402 :fowl!~fowl@user/fowl QUIT :*.net *.split
< 1736824202 961619 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :*.net *.split
< 1736824204 76977 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :*.net *.split
< 1736824204 583455 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :*.net *.split
< 1736824204 815476 :sprout!~sprout@84-80-106-227.fixed.kpn.net QUIT :*.net *.split
< 1736824501 763969 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736824501 819352 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
< 1736824501 819441 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736824501 819494 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo
< 1736824501 819529 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1736824501 819573 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736824501 819614 :sprout!~sprout@84-80-106-227.fixed.kpn.net JOIN #esolangs sprout :sprout
< 1736824610 658761 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736825253 214384 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 252 seconds
> 1736827868 311844 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 N10 02https://esolangs.org/w/index.php?oldid=150119 5* 03Jan jelo 5* (+2102) 10Created page with "This is a [[Underload]] interpreter in scheme by [[User:Jan jelo]]. (define(init program) (list(string->list program) '())) (define(program state) (list-ref state 0)) (define(stack state) (list-ref state 1)) ;a (define(a state)
> 1736827991 266293 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150120&oldid=150062 5* 03Jan jelo 5* (+39) 10/* Intepreters */
> 1736829533 843585 PRIVMSG #esolangs :14[[07PDAsephtwo14]]4 N10 02https://esolangs.org/w/index.php?oldid=150121 5* 03BoundedBeans 5* (+16102) 10Created page with "PDAseptwo is an extension of [[PDAsephone]] by [[User:BoundedBeans]], made in January 2025. ==Storage== PDAsephone normally has two stacks, a stack of characters and a stack of instances of [[push-down automata]]. Each push-down automaton has a stack of charac
> 1736829580 379559 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150122&oldid=150098 5* 03BoundedBeans 5* (+17) 10
> 1736829661 1323 PRIVMSG #esolangs :14[[07User:BoundedBeans14]]4 10 02https://esolangs.org/w/index.php?diff=150123&oldid=148989 5* 03BoundedBeans 5* (+108) 10
> 1736829670 718213 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 10 02https://esolangs.org/w/index.php?diff=150124&oldid=150119 5* 03Jan jelo 5* (+1) 10
> 1736830083 379718 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150125&oldid=127692 5* 03BoundedBeans 5* (+0) 10Wrong fingerprint name
> 1736830462 937894 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150126&oldid=150125 5* 03BoundedBeans 5* (+162) 10Additional operations to GRPH
> 1736830553 731458 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150127&oldid=150126 5* 03BoundedBeans 5* (+55) 10Hyperbolic functions in GRPH
> 1736831521 844043 PRIVMSG #esolangs :14[[07Testeee14]]4 N10 02https://esolangs.org/w/index.php?oldid=150128 5* 03BestCoder 5* (+176) 10Created page with "hello i am really cool"
> 1736831534 75871 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150129&oldid=150128 5* 03BestCoder 5* (+1) 10
> 1736831544 173909 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150130&oldid=150129 5* 03BestCoder 5* (-2) 10
> 1736831556 583322 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150131&oldid=150130 5* 03BestCoder 5* (+0) 10
> 1736831566 371482 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150132&oldid=150131 5* 03BestCoder 5* (+0) 10
> 1736831576 36906 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150133&oldid=150132 5* 03BestCoder 5* (+0) 10
> 1736831585 966094 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150134&oldid=150133 5* 03BestCoder 5* (+0) 10
> 1736831594 847432 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150135&oldid=150134 5* 03BestCoder 5* (+0) 10
> 1736831603 304200 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150136&oldid=150135 5* 03BestCoder 5* (+0) 10
> 1736831634 505390 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150137&oldid=150136 5* 03BestCoder 5* (+0) 10
> 1736831643 126002 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150138&oldid=150137 5* 03BestCoder 5* (+0) 10
> 1736831661 989016 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150139&oldid=150138 5* 03BestCoder 5* (-2) 10
> 1736831669 644634 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150140&oldid=150139 5* 03BestCoder 5* (+2) 10
> 1736831679 430976 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150141&oldid=150140 5* 03BestCoder 5* (-2) 10
> 1736831700 519369 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150142&oldid=150141 5* 03BestCoder 5* (+15) 10
> 1736831718 969839 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150143&oldid=150142 5* 03BestCoder 5* (+16) 10
> 1736831728 226783 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150144&oldid=150143 5* 03BestCoder 5* (+1) 10
> 1736831740 339599 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150145&oldid=150144 5* 03BestCoder 5* (+2) 10
> 1736831760 978397 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150146&oldid=150145 5* 03BestCoder 5* (+9) 10
> 1736831796 385530 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150147&oldid=150146 5* 03BestCoder 5* (+41) 10
> 1736831820 592732 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150148&oldid=150147 5* 03BestCoder 5* (+19) 10
> 1736831834 789455 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150149&oldid=150148 5* 03BestCoder 5* (+0) 10
> 1736831854 337093 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150150&oldid=150149 5* 03BestCoder 5* (+12) 10
> 1736831864 78683 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150151&oldid=150150 5* 03BestCoder 5* (+2) 10
> 1736831891 858102 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150152&oldid=150151 5* 03BestCoder 5* (+23) 10
> 1736831903 362732 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150153&oldid=150152 5* 03BestCoder 5* (-2) 10
> 1736831921 178524 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150154&oldid=150153 5* 03BestCoder 5* (+16) 10
> 1736831934 802167 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150155&oldid=150154 5* 03BestCoder 5* (+77) 10
> 1736831956 911579 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150156&oldid=150155 5* 03BestCoder 5* (+336) 10
> 1736832039 124322 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150157&oldid=150092 5* 03BestCoder 5* (+30) 10/* UHH */
> 1736832155 625024 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=150158&oldid=149441 5* 03BestCoder 5* (-9) 10
> 1736832291 941769 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150159&oldid=150156 5* 03BestCoder 5* (+99) 10
> 1736832305 549012 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150160&oldid=150159 5* 03BestCoder 5* (+8) 10
> 1736832337 179629 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150161&oldid=150160 5* 03BestCoder 5* (+1) 10
> 1736832364 815788 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150162&oldid=150161 5* 03BestCoder 5* (+428) 10
> 1736832378 768394 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150163&oldid=150162 5* 03BestCoder 5* (-536) 10
> 1736832391 305431 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150164&oldid=150163 5* 03BestCoder 5* (-40) 10
> 1736832399 536940 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150165&oldid=150164 5* 03BestCoder 5* (-22) 10
> 1736832415 366766 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150166&oldid=150165 5* 03BestCoder 5* (-217) 10
> 1736838780 229108 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02Testeee10]]": offtopic (not an esolang)
< 1736839029 684350 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736843108 253366 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736846916 453908 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 246 seconds
> 1736847039 5824 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Piet; 5* 10New user account
> 1736847378 2559 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150167&oldid=150060 5* 03Piet; 5* (+158) 10
< 1736848017 863466 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1736848264 479088 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736848558 123648 :APic!apic@apic.name PRIVMSG #esolangs :Hi
> 1736853176 967239 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150168&oldid=150063 5* 03MihaiEso 5* (+164) 10
< 1736854048 427646 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1736856149 240278 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736856331 823292 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736857079 905611 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736857456 999106 :chomwitt_mobile!~alex@ppp-94-67-201-217.home.otenet.gr JOIN #esolangs chomwitt :realname
< 1736857566 517635 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736857697 632691 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736857740 631516 PRIVMSG #esolangs :14[[07Beunfunge14]]4 N10 02https://esolangs.org/w/index.php?oldid=150169 5* 03None1 5* (+265) 10Created page with "'''Beunfunge''' is an esolang invented by [[User:None1]]. It is [[Befunge]], but there's no self modifying. ==Examples== Many examples in Befunge work in Beunfunge too, but some do not. [[Category:Two-dimensional languages]] [[Category:Languages]] [[Category:2025]]"
> 1736858584 760448 PRIVMSG #esolangs :14[[07User:Thalassohora14]]4 10 02https://esolangs.org/w/index.php?diff=150170&oldid=115547 5* 03Thalassohora 5* (-134) 10
< 1736858856 826618 :chomwitt_mobile!~alex@ppp-94-67-201-217.home.otenet.gr QUIT :Remote host closed the connection
> 1736860184 618040 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 10 02https://esolangs.org/w/index.php?diff=150171&oldid=149330 5* 03Jan jelo 5* (+1251) 10/* Examples */
> 1736860214 479379 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 M10 02https://esolangs.org/w/index.php?diff=150172&oldid=150171 5* 03Jan jelo 5* (+2) 10
< 1736860983 718011 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736862630 263460 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736862993 836735 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150173&oldid=148099 5* 03I am islptng 5* (+580) 10/* desmos */ new section
< 1736863045 179691 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu JOIN #esolangs b_jonas :[https://web.libera.chat] wib_jonas
< 1736863057 22158 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :`olist 1317
< 1736863061 219258 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :olist : shachaf oerjan Sgeo boily nortti b_jonas Noisytoot
< 1736863063 474701 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :I think that might be my fastest olist yet
< 1736865349 377056 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba PRIVMSG #esolangs :Does anyone know an algorithm to calculate the nash equilibrium percentage of a big matrix? The kind of equilibrium where the matrix contains scores of something in the row vs something in the column, and the equilibrium is x% percent of the first row, y% of the second row, z% of the third row, etc, which gives everything exactly the same score.
< 1736865392 426841 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1736865445 22078 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba PRIVMSG #esolangs :Google is just showing me how to find the equilibrium in 2x2 matrices, so I'm wondering if what I'm looking for has another name.
< 1736867024 184484 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu QUIT :Quit: Client closed
< 1736868075 184182 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu JOIN #esolangs b_jonas :[https://web.libera.chat] wib_jonas
< 1736868210 281443 :fowl!~fowl@user/fowl QUIT :Quit: Ping timeout (120 seconds)
< 1736868242 97460 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736869224 114520 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736869230 178958 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736869372 173576 :int-e!~noone@int-e.eu PRIVMSG #esolangs :impomatic: If it's a zero sum game, there's a linear programming formulation for that; https://en.wikipedia.org/wiki/Zero-sum_game#Solving ... otherwise it'http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
< 1736869411 365153 :int-e!~noone@int-e.eu PRIVMSG #esolangs :...otherwise it's something called PPAD-complete that I have not yet understood, http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
< 1736869433 246889 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(gotta love fat-fingering '- )
< 1736869536 119427 :int-e!~noone@int-e.eu PRIVMSG #esolangs :impomatic: in any case that's what I guess your question was, so hopefully that's good for some alternative keywords.
< 1736869681 303799 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Beautiful. Firefox is blocking http links returned by https://html.duckduckgo.com/html/ because they are a "Potential security risk".
< 1736870112 427339 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
> 1736870138 991245 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150174&oldid=150173 5* 03Ractangle 5* (+200) 10/* desmos */
> 1736870745 769961 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150175&oldid=150174 5* 03I am islptng 5* (+645) 10
< 1736871640 676605 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu QUIT :Ping timeout: 240 seconds
< 1736873098 66932 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736873920 493691 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150176&oldid=150175 5* 03Jan jelo 5* (+202) 10/* desmos */
< 1736874834 964814 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :PPAD-complete is more-or-less FNP-complete, FWIW; we haven't proven it yet, but there's piles of evidence and my prior is at something like 97%.
< 1736874870 638149 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :IOW free markets probably are not efficient; there are probably cases where a free market can't avoid sitting exponentially far from Nash equilibrium for exponentially long.
< 1736874922 448060 :int-e!~noone@int-e.eu PRIVMSG #esolangs :you mean on top of all the other things that are obviously going wrong with that theory?
< 1736874929 447509 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(rational agents, lol)
< 1736874953 861171 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Of course, yeah. (Personally I'm still waiting for a categorical formulation of markets; absent one, I'm not convinced that they have a nice algebraic theory.)
< 1736875136 310832 :int-e!~noone@int-e.eu PRIVMSG #esolangs :korvo: what exactly is FNP? f(x) = y can be verified in polynomial time?
< 1736875150 388264 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(I can look it up if the answer is no)
< 1736875175 987257 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(I guess I could look it up regardless :-P)
< 1736875194 237664 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :int-e: I think there's a couple equivalent formulations. I think of it as a generalization of ♯NP; it's like NP but all problems are valued in nats instead of Booleans.
< 1736875292 284861 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But we can take any countable domain, I think, so that we can have functions M -> {R} from markets to computable sets of computable reals. And that would formalize Nash equilibria, given a formalization of markets.
< 1736875315 208095 :int-e!~noone@int-e.eu PRIVMSG #esolangs :hah, of course "FNP class" does not eliminate the "family nurse practitioner" false positive ;) ("complexity" did the trick)
< 1736875394 789195 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :In this case, the part that's quick to verify is a function R × M -> 2 which checks that a particular market valuation is Nash by checking that each market participant doesn't have any better options; the part that's expensive is computing the history of the market's evolution.
< 1736875446 847046 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmm not sure I see the #NP (model counting) connection.
< 1736875540 349256 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Nash equilibria aren't unique; there's multiple possible histories which converge.
< 1736875598 327999 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I mean, FNP doesn't count.
< 1736875617 451597 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, sure. It's more general than that.
< 1736875657 193767 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I mean, yes, I'm wrong; I'm just saying that I think of function problems as generalized counting of decision problems.
< 1736875670 767579 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I guess you can ask how many solutions there are and then it becomes #NP, more or less.
< 1736876402 97852 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs : /query hackeso
< 1736876404 22413 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :uh
< 1736876631 49482 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :https://complexityzoo.net/Complexity_Zoo:F#fnp doesn't seem to say that there's such a thing as FNP-completeness
< 1736877118 316902 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Aaronson omits many things, but yeah, it could well be the case that there's no such notion of completeness under reductions.
< 1736877163 229059 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :do you know what kind of reduction this needs?
< 1736877172 318698 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Note that there's no such notion of PPAD-completeness either. It happens to be the case that the problem of finding Nash equilibria is complete for PPAD, but I'm not sure if there's a nice category PPADC of such problems or if Nash is a special case.
< 1736877194 10603 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :different reductions can result in different notions of completness I think
< 1736877219 577251 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but maybe it's obvious in this case
< 1736877219 825974 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I imagine it's the same sort of reduction as in NP-completeness: a computable poly-time rewrite of the input problem. I'd guess that we also need a contravariant computable poly-time adapter for the output, so that we can transform the outputs from one problem to another too.
< 1736877245 647636 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, yes, for sure. For example the category NPC is specifically about computable poly-time reductions.
< 1736877400 268664 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :and like sometimes you want to allow multiple calls to an oracle
< 1736877467 628711 :int-e!~noone@int-e.eu PRIVMSG #esolangs :korvo: you might have to poly-time manipulate the output too?
< 1736877592 17145 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ooh, this may be relevant: https://complexityzoo.net/Complexity_Zoo_References#dgp05
< 1736877674 528436 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :C. Daskalakis, P. W. Goldberg, and C. H. Papadimitriou "The Complexity of Computing a Nash Equilibrium", SIAM J. Comput. 39(1):195-259, 2009. doi:10.1137/070699652 Originally appeared in STOC 2006, Author's website conference version "https://people.csail.mit.edu/costis/simplified.pdf" .
< 1736877763 873716 :int-e!~noone@int-e.eu PRIVMSG #esolangs :yeah the PDF I linked above is a follow-up for that work (well, an earlier technical report version of it)
< 1736877805 232139 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :int-e: Yeah. Like, imagine each function problem is a general arrow I -> O in some category. To transform it to X -> Y, we need both X -> I and also O -> Y, with the latter contravariant. This doesn't matter for NPC because everything is X -> 2 there.
< 1736877813 682726 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :oh good
< 1736878127 720915 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736878137 422860 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com PRIVMSG #esolangs :Thanks int-e
< 1736878196 117110 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com QUIT :Client Quit
< 1736879404 658436 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736879480 40185 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736879900 421880 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736879972 912431 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 272 seconds
< 1736880057 671096 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736880075 670753 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736880627 660028 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150177&oldid=150108 5* 03Jan jelo 5* (+947) 10/* Examples */
> 1736880893 429786 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=150178&oldid=149501 5* 03Jan jelo 5* (+955) 10/* Examples */
> 1736880954 149360 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150179&oldid=150178 5* 03Jan jelo 5* (+4) 10/* 99 bottles of beer */
> 1736880997 947756 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150180&oldid=150179 5* 03Jan jelo 5* (+5) 10/* Hello, world! */
> 1736882863 712567 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150181&oldid=150059 5* 0347 5* (-12) 10
< 1736885615 122022 :int-e!~noone@int-e.eu QUIT :Remote host closed the connection
< 1736885653 270170 :int-e!~noone@int-e.eu JOIN #esolangs int-e :Bertram
< 1736885690 987728 :lambdabot!~lambdabot@haskell/bot/lambdabot QUIT :Remote host closed the connection
< 1736885787 568670 :lambdabot!~lambdabot@haskell/bot/lambdabot JOIN #esolangs lambdabot :Lambda_Robots:_100%_Loyal
> 1736885946 214379 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150182&oldid=149983 5* 03Ractangle 5* (+437) 10/* Syntax */
> 1736886011 750019 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150183&oldid=150182 5* 03Ractangle 5* (+0) 10the r is lowercase
< 1736886261 110434 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736886261 167719 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
> 1736886662 517790 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150184&oldid=150183 5* 03Ractangle 5* (+7) 10/* The IMP */
< 1736887645 32541 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736888587 904638 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150185&oldid=150177 5* 03Jan jelo 5* (-6) 10/* Muriel */
> 1736888675 473225 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150186&oldid=150180 5* 03Jan jelo 5* (-5) 10/* FizzBuzz */
> 1736888847 182360 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150187&oldid=149232 5* 03Jan jelo 5* (+4) 10
> 1736889428 715684 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 M10 02https://esolangs.org/w/index.php?diff=150188&oldid=150124 5* 03Jan jelo 5* (+212) 10
> 1736890244 632786 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 N10 02https://esolangs.org/w/index.php?oldid=150189 5* 03FluixMakesEsolangs 5* (+1133) 10Initial version of this page
> 1736890282 458143 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 M10 02https://esolangs.org/w/index.php?diff=150190&oldid=150189 5* 03FluixMakesEsolangs 5* (+6) 10Fixed grammer error
> 1736890313 349361 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 10 02https://esolangs.org/w/index.php?diff=150191&oldid=150190 5* 03FluixMakesEsolangs 5* (-96) 10
> 1736890360 71967 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 M10 02https://esolangs.org/w/index.php?diff=150192&oldid=150191 5* 03FluixMakesEsolangs 5* (+34) 10fixed some stuff
> 1736893419 809504 PRIVMSG #esolangs :14[[07Beunfunge14]]4 M10 02https://esolangs.org/w/index.php?diff=150193&oldid=150169 5* 03Aadenboy 5* (+9) 10stub
< 1736893954 242259 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
< 1736894940 378998 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736896169 380166 :fowl0!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736896195 955248 :fowl!~fowl@user/fowl QUIT :Read error: Connection reset by peer
< 1736896196 365014 :fowl0!~fowl@user/fowl NICK :fowl
< 1736897674 20208 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736899410 100579 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds
< 1736899416 477615 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736899460 510921 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
< 1736899510 106096 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736899980 307477 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736900910 306113 :APic!apic@apic.name PRIVMSG #esolangs :Night
< 1736901099 289882 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :night
< 1736901172 818586 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Night.
< 1736902310 381775 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736907690 44386 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736907769 615227 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736910338 323797 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736910511 946690 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736910530 375076 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1736910599 537753 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736911045 735413 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection
< 1736911076 121948 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736911372 922409 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection
< 1736912417 515662 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
> 1736922493 195115 PRIVMSG #esolangs :14[[07BitTurn14]]4 N10 02https://esolangs.org/w/index.php?oldid=150194 5* 03I am islptng 5* (+477) 10Created page with "BitTurn is an esolang that operates on a 2D bitmap. The pointer can read/write the bits on the map and move. ==Commands== {|class=wikitable ! Command !! Meaning |- | | || Flip the current bit pointing and move forward. |- | 1736926936 521416 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150195&oldid=146885 5* 0347 5* (-67) 10
> 1736927158 645107 PRIVMSG #esolangs :14[[07BIX Queue Subset14]]4 10 02https://esolangs.org/w/index.php?diff=150196&oldid=132672 5* 0347 5* (+22) 10/* See also */
> 1736927293 324358 PRIVMSG #esolangs :14[[07Brainmaker14]]4 10 02https://esolangs.org/w/index.php?diff=150197&oldid=73046 5* 0347 5* (+23) 10/* Interpreters */
> 1736927498 997519 PRIVMSG #esolangs :14[[07Number factory14]]4 10 02https://esolangs.org/w/index.php?diff=150198&oldid=130968 5* 03Piet; 5* (+49) 10
> 1736927533 422728 PRIVMSG #esolangs :14[[07Number Factory14]]4 10 02https://esolangs.org/w/index.php?diff=150199&oldid=71656 5* 03Piet; 5* (+49) 10
< 1736928365 570394 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736930676 391269 :craigo!~craigo@user/craigo QUIT :Remote host closed the connection
> 1736934238 998790 PRIVMSG #esolangs :14[[07StackedDeck14]]4 N10 02https://esolangs.org/w/index.php?oldid=150200 5* 03Ashli Katt 5* (+6746) 10Create page for StackedDeck, specification incomplete temporarily.
> 1736934708 374884 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150201&oldid=150200 5* 03Ashli Katt 5* (-1) 10/* Execution */
> 1736935189 586110 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150202&oldid=150201 5* 03Ashli Katt 5* (+0) 10/* Card Execution */
< 1736936425 963489 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736941549 479307 PRIVMSG #esolangs :14[[07Talk:Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150203&oldid=150051 5* 03PrySigneToFry 5* (+1244) 10
< 1736942107 188160 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736942107 224495 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1736942357 285773 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 N10 02https://esolangs.org/w/index.php?oldid=150204 5* 03PrySigneToFry 5* (+2130) 10Created page with "1. Take that [[Translated /Mihai Again!|]]. ** ** ** ** ** ..."
> 1736942433 784353 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150205&oldid=150168 5* 03PrySigneToFry 5* (+64) 10
< 1736942591 64151 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736942726 220725 :int-e!~noone@int-e.eu PRIVMSG #esolangs :`? password
< 1736942730 298155 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :password The password of the month is not from a jedi.
< 1736942781 14282 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736943578 708225 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :Quit: Lost terminal
> 1736948642 642927 PRIVMSG #esolangs :14[[07User:Gilbert189/Iternary14]]4 10 02https://esolangs.org/w/index.php?diff=150206&oldid=140378 5* 03Gilbert189 5* (+1658) 10
> 1736948660 478575 PRIVMSG #esolangs :14[[07User:Gilbert189/A way to golf Baba is You esolangs14]]4 10 02https://esolangs.org/w/index.php?diff=150207&oldid=129056 5* 03Gilbert189 5* (+20) 10added WRITE and BOOM
< 1736951282 639087 :APic!apic@apic.name PRIVMSG #esolangs :Hi
> 1736951376 646572 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150208&oldid=149016 5* 03Unname4798 5* (+160) 10
> 1736951399 716190 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150209&oldid=150208 5* 03Unname4798 5* (+7) 10
> 1736951415 844438 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150210&oldid=150209 5* 03Unname4798 5* (+0) 10
< 1736951783 263540 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736952537 675520 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1736953537 861495 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150211&oldid=150185 5* 03Jan jelo 5* (+29) 10/* TeX */
< 1736953680 382517 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1736954260 643248 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Ping timeout: 240 seconds
< 1736955515 181940 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
< 1736955515 258549 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
< 1736955899 677018 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736956057 489589 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736956074 719205 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736956978 669345 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736959528 119670 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150212&oldid=142604 5* 03Jan jelo 5* (+469) 10/* Sample programs */
> 1736959566 230328 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150213&oldid=150212 5* 03Jan jelo 5* (+1) 10/* Sample programs */
> 1736960016 687921 PRIVMSG #esolangs :14[[07++===14]]4 N10 02https://esolangs.org/w/index.php?oldid=150214 5* 03PkmnQ 5* (+1414) 10Created page with "[[++===]] is a register-based [[OISC]] with no branching. The name is a concatenation of ++, ==, and =, describing the singular instruction (if (*A++ == *B) *A = *C;). == Specification == Memory in [[
> 1736960650 315041 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150215&oldid=150213 5* 03Jan jelo 5* (+0) 10/* Sample programs */
< 1736963070 483654 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736963437 935676 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150216&oldid=150167 5* 03WinslowJosiah 5* (+141) 10
> 1736963471 741510 PRIVMSG #esolangs :14[[07Bespoke14]]4 N10 02https://esolangs.org/w/index.php?oldid=150217 5* 03WinslowJosiah 5* (+10960) 10Created page with "'''Bespoke''' is an [[esoteric programming language]] created in 2025 by Josiah Winslow. It encodes instructions into the lengths of words, similarly to his earlier esolang [[Poetic (esolang)|Poetic]]. Programs can tend to look like abstract poetry, although a se
< 1736964474 982345 :b_jonas!~x@88.87.242.184 JOIN #esolangs * :b_jonas
< 1736965092 434928 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :you know how in Windows, if you want to enter a unicode code point of which you know the code, you can open either WordPad or Word, enter the number in hexadecimal, then press alt+X, right? Now I was told that some future version of Windows might not include WordPad by default. Sounds bad, right? How will you enter arbitrary code points without installing additional software. Nope, actually TIL that
< 1736965098 611154 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Windows 11's version of Notepad supports this too, so no need to use Wordpad for this on Windows 11 machines.
< 1736965214 662909 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :*.net *.split
< 1736965214 700687 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :*.net *.split
< 1736965215 527494 :Artea!~Lufia@artea.pt QUIT :*.net *.split
< 1736965216 998036 :MizMahem!sid296354@user/mizmahem QUIT :*.net *.split
< 1736965217 822878 :myname!~myname@v2202404221793264578.bestsrv.de QUIT :*.net *.split
< 1736965344 55527 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736965344 136144 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736965344 136206 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
< 1736965344 136237 :MizMahem!sid296354@user/mizmahem JOIN #esolangs MizMahem :🐍🐔
< 1736965344 136245 :myname!~myname@v2202404221793264578.bestsrv.de JOIN #esolangs myname :myname
< 1736965347 408737 :Artea!~Lufia@artea.pt QUIT :Max SendQ exceeded
< 1736966121 106562 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736966121 144391 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736966336 544225 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736966367 311393 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 244 seconds
< 1736966513 337239 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736966617 878674 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
< 1736967926 918741 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1736968328 465160 PRIVMSG #esolangs :14[[07User:Aadenboy/Ultimate warsides14]]4 N10 02https://esolangs.org/w/index.php?oldid=150218 5* 03Aadenboy 5* (+6081) 10ULTIMATE WARSIDES.
> 1736968689 254681 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150219&oldid=149919 5* 03Aadenboy 5* (+38) 10add [[User:Aadenboy/Ultimate warsides]]
> 1736971800 200560 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150220&oldid=150184 5* 03Ractangle 5* (+0) 10/* The IMP */
< 1736972853 106265 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736972853 187651 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736976134 777641 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736978342 46948 :mtm_!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736978450 42112 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736980329 429364 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca QUIT :Ping timeout: 246 seconds
> 1736980721 667639 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150221&oldid=150211 5* 03Jan jelo 5* (+2494) 10/* Thue */
< 1736980787 806979 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736981047 328721 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca JOIN #esolangs zzo38 :zzo38
> 1736981793 964463 PRIVMSG #esolangs :14[[07User:Jan jelo/FizzBuzz in Thue14]]4 N10 02https://esolangs.org/w/index.php?oldid=150222 5* 03Jan jelo 5* (+2569) 10Created page with "This is a [[FizzBuzz]] program in [[Thue]] by [[User: Jan jelo]]. Outputs are separated by ;. o0::=~0 o1::=~1 o2::=~2 o3::=~3 o4::=~4 o5::=~5 o6::=~6 o7::=~7 o8::=~8 o9::=~9 0[<0]::=0[3>] 1[<0]::=[<1]1 2[<0]::=2[3>] 3[<0]::=3[
< 1736982438 795291 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736982546 440693 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736982724 210372 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :The podcast "Future of Coding" is updating again! Their recent episode is about whether the universe is a computer. https://futureofcoding.org/episodes/074
< 1736983031 521784 :molson_!~molson@2605-4A80-2101-99D0-4EAD-E7D9-1255-7D90-dynamic.midco.net JOIN #esolangs molson :realname
< 1736983269 381500 :molson!~molson@2605-4A80-2101-99D0-6F3C-C8E-3717-10C4-dynamic.midco.net QUIT :Ping timeout: 276 seconds
> 1736984056 267646 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150223&oldid=150120 5* 03Jan jelo 5* (+36) 10/* Other */
< 1736985365 399859 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736985531 473315 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 276 seconds
< 1736985765 496714 :mtm_!~textual@47.202.75.129 QUIT :Ping timeout: 276 seconds
< 1736985978 618011 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736992201 658107 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736992771 555142 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Quit: Leaving
< 1736992792 405832 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736992801 362264 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Remote host closed the connection
< 1736992854 603133 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736993079 144730 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736995446 940860 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736997380 422738 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736997643 361668 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736998754 741926 PRIVMSG #esolangs :14[[07Trajedy14]]4 10 02https://esolangs.org/w/index.php?diff=150224&oldid=52419 5* 03Jafetish 5* (+5) 10/* Implementation */ update URL
> 1737000574 985360 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 10 02https://esolangs.org/w/index.php?diff=150225&oldid=150064 5* 03Piet; 5* (+271) 10/* Bespoke */
< 1737000741 434151 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 276 seconds
< 1737001027 816837 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1737002031 627970 PRIVMSG #esolangs :14[[07++===14]]4 10 02https://esolangs.org/w/index.php?diff=150226&oldid=150214 5* 03PkmnQ 5* (+88) 10/* Specification */
< 1737002668 270396 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 244 seconds
< 1737005390 418913 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737007605 670885 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :
< 1737008689 304179 :craigo!~craigo@user/craigo QUIT :Read error: Connection reset by peer
< 1737008707 441392 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737009133 940897 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737009396 410239 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737010649 32870 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737010776 68306 :Sgeo_!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737011002 71906 :Sgeo!~Sgeo@user/sgeo QUIT :Ping timeout: 265 seconds
< 1737012760 747132 :Sgeo_!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737012908 967390 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737012909 4947 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737012919 496908 :ProofTechnique_!sid79547@id-79547.ilkley.irccloud.com QUIT :*.net *.split
< 1737013237 547079 :ProofTechnique_!sid79547@id-79547.ilkley.irccloud.com JOIN #esolangs * :ptech
< 1737013906 68706 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737015976 354548 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
< 1737015976 554139 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
< 1737018150 434322 :craigo!~craigo@user/craigo QUIT :Ping timeout: 246 seconds
> 1737019175 391827 PRIVMSG #esolangs :14[[07Print("Hello, World!")14]]4 10 02https://esolangs.org/w/index.php?diff=150227&oldid=148535 5* 03Piet; 5* (+95) 10/* Python */
> 1737019658 680022 PRIVMSG #esolangs :14[[07Print("Hello, World!")14]]4 M10 02https://esolangs.org/w/index.php?diff=150228&oldid=150227 5* 03Piet; 5* (+7) 10
< 1737022968 562421 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737023083 431823 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737023218 508289 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737023329 967908 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737023355 661897 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737027594 519736 PRIVMSG #esolangs :14[[07Beunfunge14]]4 10 02https://esolangs.org/w/index.php?diff=150229&oldid=150193 5* 03None1 5* (+123) 10
> 1737027766 624873 PRIVMSG #esolangs :14[[07Cardinal14]]4 10 02https://esolangs.org/w/index.php?diff=150230&oldid=62320 5* 03Piet; 5* (+25134) 10/* Rule 110 */ Possibly Turing-complete
> 1737027867 978543 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150231&oldid=150204 5* 03PrySigneToFry 5* (+417) 10
> 1737028030 888530 PRIVMSG #esolangs :14[[07Talk:Cardinal14]]4 N10 02https://esolangs.org/w/index.php?oldid=150232 5* 03Piet; 5* (+230) 10Proof of Turing-completeness
> 1737028146 712929 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150233&oldid=150011 5* 03Piet; 5* (+214) 10/* Is Cardinal Turing-complete? */ new section
> 1737028399 179430 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150234&oldid=150231 5* 03PrySigneToFry 5* (+986) 10
> 1737028726 927123 PRIVMSG #esolangs :14[[07Talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150235&oldid=150052 5* 03PrySigneToFry 5* (+374) 10
> 1737028945 607064 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=150236&oldid=149883 5* 03PrySigneToFry 5* (+385) 10
< 1737029061 248163 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737029144 731568 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737030523 819984 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737033376 47563 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150237&oldid=150122 5* 03None1 5* (+16) 10/* B */
< 1737033680 95141 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 265 seconds
< 1737034505 499448 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1737034802 287441 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=150238&oldid=149712 5* 03None1 5* (+51) 10/* My Esolangs */
< 1737035523 909088 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737035752 597685 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737039217 372506 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737039847 920060 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737040112 428949 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737040596 480629 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737042245 935712 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737042918 328428 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737043475 439693 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737044339 674322 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737044466 414273 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737047544 434039 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737047604 831758 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737049023 453211 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1737049106 974042 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737049618 129377 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737050645 437619 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Shannarra 5* 10New user account
> 1737050886 185011 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150239&oldid=150216 5* 03Shannarra 5* (+125) 10/* Introductions */
< 1737050970 952781 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737051071 434516 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737051310 73996 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150240&oldid=150237 5* 03Shannarra 5* (+15) 10/* S */
> 1737052409 395289 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150241&oldid=150221 5* 03Blashyrkh 5* (+2420) 10/* Lazy K */ Another (a bit shorter) version of FizzBuzz written in Lazy K
> 1737052573 738634 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150242&oldid=150241 5* 03Blashyrkh 5* (+9) 10/* Lazy K */
> 1737052658 661451 PRIVMSG #esolangs :14[[07Sapphire14]]4 N10 02https://esolangs.org/w/index.php?oldid=150243 5* 03Shannarra 5* (+1545) 10Sapphire - Ruby's evil twin language.
> 1737052681 695803 PRIVMSG #esolangs :14[[07Sapphire14]]4 10 02https://esolangs.org/w/index.php?diff=150244&oldid=150243 5* 03Shannarra 5* (-5) 10
< 1737052800 89434 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737052845 457525 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1737052880 620739 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737053805 564438 PRIVMSG #esolangs :14[[07Church numeral14]]4 M10 02https://esolangs.org/w/index.php?diff=150245&oldid=149108 5* 03Jan jelo 5* (+0) 10/* Arithmetic */
< 1737054956 463620 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 252 seconds
< 1737055389 143869 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737055408 209815 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150246&oldid=150240 5* 03WinslowJosiah 5* (+14) 10Add Bespoke
> 1737055568 51429 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (B-C)14]]4 10 02https://esolangs.org/w/index.php?diff=150247&oldid=148318 5* 03WinslowJosiah 5* (+378) 10Add Hello World in Bespoke
> 1737056187 73828 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150248&oldid=150102 5* 03Jan jelo 5* (+162) 10/* Examples */
> 1737056412 828494 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150249&oldid=139532 5* 03Blashyrkh 5* (+262) 10/* Merely an encoding */
> 1737057608 812863 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150250&oldid=150249 5* 03Blashyrkh 5* (+10) 10/* Merely an encoding */
> 1737060440 989080 PRIVMSG #esolangs :14[[07Propositio14]]4 M10 02https://esolangs.org/w/index.php?diff=150251&oldid=147380 5* 03 5* (+2) 10Fixed syntax
> 1737061279 434231 PRIVMSG #esolangs :14[[07Closuretalk14]]4 M10 02https://esolangs.org/w/index.php?diff=150252&oldid=149203 5* 03Rdococ 5* (-100) 10/* Conclusion */
> 1737061459 843553 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150253&oldid=150250 5* 03Ais523 5* (+491) 10/* Merely an encoding */ a matter of perspective
< 1737062312 939509 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
> 1737063102 374583 PRIVMSG #esolangs :14[[07CContains14]]4 N10 02https://esolangs.org/w/index.php?oldid=150254 5* 03 5* (+848) 10Started page
> 1737063111 741201 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150255&oldid=148127 5* 03Ractangle 5* (-21) 10/* Syntax */
> 1737063343 635481 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150256&oldid=150255 5* 03Ractangle 5* (-148) 10/* Cat program */
> 1737063390 880981 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150257&oldid=150256 5* 03Ractangle 5* (-4) 10/* Cat program */
> 1737063492 413805 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150258&oldid=150257 5* 03Ractangle 5* (-92) 10
> 1737063673 126676 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150259&oldid=149995 5* 03Ractangle 5* (-16) 10/* Stuff to continue */
> 1737063701 284898 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150260&oldid=149987 5* 03Ractangle 5* (+16) 10/* Esolangs */
> 1737063811 774097 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150261&oldid=149860 5* 03Ractangle 5* (+62) 10/* Commands */
> 1737063872 451823 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150262&oldid=150261 5* 03Ractangle 5* (+34) 10/* Truth-machine */
> 1737063895 461766 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150263&oldid=150262 5* 03Ractangle 5* (-1) 10/* Truth-machine */
> 1737063916 31014 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150264&oldid=150263 5* 03Ractangle 5* (-1) 10/* Commands */
< 1737064010 307168 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737064120 736701 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150265&oldid=150264 5* 03Ractangle 5* (-75) 10/* Commands */
> 1737064221 180547 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150266&oldid=150265 5* 03Ractangle 5* (-32) 10/* Infinite Loop */
> 1737064302 937839 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150267&oldid=150266 5* 03Ractangle 5* (+1) 10/* Infinite Loop */
> 1737064966 201301 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150268&oldid=150267 5* 03Ractangle 5* (+259) 10/* Examples */
> 1737064996 717784 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150269&oldid=150268 5* 03Ractangle 5* (+3) 10/* Hello world */
> 1737065267 77627 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150270&oldid=150269 5* 03Ractangle 5* (+2) 10/* Truth-machine */
< 1737065443 744805 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
> 1737066173 509946 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=150271&oldid=149882 5* 03Calculus is fun 5* (+20) 10Added People Category
> 1737066369 838475 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=150272&oldid=149244 5* 03Jan jelo 5* (+298) 10
< 1737066641 298519 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737066651 263476 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150273&oldid=150107 5* 03Calculus is fun 5* (+43) 10/* Examples elsewhere on this site */
< 1737066894 15476 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737067211 573760 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150274&oldid=150219 5* 03Aadenboy 5* (+21) 10zzzzzzzz whatever people category jumpscare
> 1737069030 517380 PRIVMSG #esolangs :14[[07User:FluixMakesEsolangs14]]4 N10 02https://esolangs.org/w/index.php?oldid=150275 5* 03FluixMakesEsolangs 5* (+143) 10Initial version of this page
< 1737069280 882596 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737070864 121193 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737071606 940251 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737071667 340480 :mtm_!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1737071696 512428 :mtm!~textual@47.202.75.129 QUIT :Read error: Connection reset by peer
> 1737074313 61099 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=150276&oldid=150272 5* 03Jan jelo 5* (-298) 10
< 1737080730 265107 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737082930 561239 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737084282 474986 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 252 seconds
< 1737084916 62228 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737084970 53303 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737086977 641340 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150277&oldid=150234 5* 03PrySigneToFry 5* (+31) 10
> 1737087811 118994 PRIVMSG #esolangs :14[[07StackedDeck14]]4 10 02https://esolangs.org/w/index.php?diff=150278&oldid=150202 5* 03Ashli Katt 5* (+529) 10Describe the Discard Pile and Sleeve
> 1737089699 991070 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150279&oldid=150278 5* 03Ashli Katt 5* (+611) 10Fill in some card effects
< 1737091273 536196 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737092608 938930 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737093428 270602 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737093787 383540 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737095783 840539 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737095939 973458 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737096312 785883 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737096572 729277 PRIVMSG #esolangs :14[[0714]]4 N10 02https://esolangs.org/w/index.php?oldid=150280 5* 03None1 5* (+1294) 10Created page with " is an esolang invented by [[User:None1]] that uses Chinese characters, what a Chinese character does depends on the radical of it. It has a stack that stores unbounded signed integers ==Commands== {| class="wikitable" ! Radical !! Meaning !! Example of Chinese characters |- |
> 1737096609 493300 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150281&oldid=150246 5* 03None1 5* (+13) 10/* Non-alphabetic */
> 1737096637 283050 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=150282&oldid=150238 5* 03None1 5* (+53) 10/* My Esolangs */
< 1737098068 147917 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737098599 19939 PRIVMSG #esolangs :14[[07Cardinal14]]4 M10 02https://esolangs.org/w/index.php?diff=150283&oldid=150230 5* 03Piet; 5* (+9) 10Link
< 1737101776 848786 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737102269 901047 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1737103541 98697 :Melvar!~melvar@dslb-088-070-034-006.088.070.pools.vodafone-ip.de QUIT :Ping timeout: 248 seconds
< 1737103589 311098 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Read error: Connection reset by peer
< 1737103645 273509 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737105717 133753 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737106777 416596 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150284&oldid=149387 5* 03Jan jelo 5* (+1035) 10/* Tracing the ~ replacement code */
> 1737106806 408330 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150285&oldid=150284 5* 03Jan jelo 5* (+86) 10/* Tracing the ~ replacement code */
> 1737107710 293184 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150286&oldid=150067 5* 03PkmnQ 5* (+288) 10/* FALSE */
> 1737108031 493270 PRIVMSG #esolangs :14[[07AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150287&oldid=133992 5* 03Piet; 5* (+2550) 10This page has been marked as Turing complete for a long time without an explicit proof.
< 1737108842 866719 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737109683 816492 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150288&oldid=120354 5* 03Tomhe 5* (+129) 10/* External resources */ Add c2fj and bf2fj
> 1737109699 518291 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150289&oldid=150288 5* 03Tomhe 5* (-3) 10/* External resources */
> 1737109985 566419 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Tomhe 5* 10uploaded "[[02File:Prime sieve.gif10]]"
> 1737110255 834713 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150291&oldid=150289 5* 03Tomhe 5* (+1068) 10Add c2fj, add flipjump primes_sieve
< 1737110436 469090 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737110734 589677 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150292&oldid=145151 5* 03Ractangle 5* (+22) 10/* Syntax */
> 1737110749 730903 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150293&oldid=150292 5* 03Ractangle 5* (-1) 10/* Truth-machine */
< 1737113913 479835 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737114961 249516 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737114972 502981 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds
< 1737115148 62012 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737115203 644161 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1737115710 585951 PRIVMSG #esolangs :14[[07X-script14]]4 N10 02https://esolangs.org/w/index.php?oldid=150294 5* 03PrySigneToFry 5* (+7705) 10Created page with "X-script is designed by PSTF. = Language Overview = X-Script is a Turing-complete, efficient, lightweight and concise programming language. It combines the simplicity of Python, the power of JavaScript, the "hacking" of assembly language, and the efficiency of C
< 1737116483 242695 :Melvar!~melvar@dslb-088-070-034-244.088.070.pools.vodafone-ip.de JOIN #esolangs Melvar :melvar
> 1737117934 964802 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150295&oldid=150293 5* 03Ractangle 5* (-2) 10/* Truth-machine */
> 1737120971 102283 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150296&oldid=150285 5* 03Jan jelo 5* (+770) 10/* Tracing the ~ replacement code */
< 1737121542 945006 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737121803 101946 PRIVMSG #esolangs :14[[07AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150297&oldid=150287 5* 03Piet; 5* (-366) 10Shorter without exponent bug - I suddenly got a message about an IP-ban that has actually been expired, so I have to borrow my friend's computer
> 1737125310 346760 PRIVMSG #esolangs :14[[07CContains14]]4 10 02https://esolangs.org/w/index.php?diff=150298&oldid=150254 5* 03 5* (+373) 10Linked to self and added commands
> 1737125387 162536 PRIVMSG #esolangs :14[[07User talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150299&oldid=147382 5* 03 5* (+18) 10
< 1737125842 43808 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
< 1737127169 484448 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737127949 891237 PRIVMSG #esolangs :14[[07User talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150300&oldid=150299 5* 03 5* (-347) 10Removed ULTRAESOLANG (i've given up)
> 1737128765 13905 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03H33T33 5* 10New user account
< 1737131043 678066 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737134020 642525 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Ping timeout: 240 seconds
< 1737135722 677224 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737136298 120828 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737136603 676999 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737136958 156958 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737137045 709586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737138057 746920 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737139269 62033 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 265 seconds
< 1737139319 211856 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737139347 156977 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Remote host closed the connection
< 1737139349 138881 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737140020 655504 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1737140639 431816 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150301&oldid=150281 5* 03Buckets 5* (+12) 10
> 1737140666 945689 PRIVMSG #esolangs :14[[07Sipes14]]4 N10 02https://esolangs.org/w/index.php?oldid=150302 5* 03Buckets 5* (+867) 10Created page with "Sipes is an esoteric language found in an old Notebook created by [[User:Buckets]] in 2019, [[User:Buckets]] has Completely forgotton the Instructions and Commands, The only Insight was It wad created April 13th 2019, A note saying 'The interpretir can be 33 toothpicks,
> 1737140749 482438 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150303&oldid=150302 5* 03Buckets 5* (+1) 10
> 1737140966 423550 PRIVMSG #esolangs :14[[07Bespoke14]]4 10 02https://esolangs.org/w/index.php?diff=150304&oldid=150217 5* 03WinslowJosiah 5* (+0) 10Fix error with H STOREVALUE docs
> 1737141085 373518 PRIVMSG #esolangs :14[[07User:Buckets14]]4 N10 02https://esolangs.org/w/index.php?oldid=150305 5* 03Buckets 5* (+41) 10Created page with "The Creator of *[[Chops]] and *[[Sipes]]."
> 1737144049 686667 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150306&oldid=150220 5* 0347 5* (+291) 10/* Syntax */
> 1737144302 155435 PRIVMSG #esolangs :14[[07CContains14]]4 10 02https://esolangs.org/w/index.php?diff=150307&oldid=150298 5* 03 5* (+1508) 10Added Container Code segment and a few more commands.
> 1737144413 304326 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150308&oldid=150306 5* 0347 5* (+378) 10
< 1737145838 871677 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com QUIT :Quit: Client closed
< 1737146462 993692 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :we must remember to choose some phrase related to Terry Pratchett to use as the password for 2025-03.
< 1737149426 911407 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737152050 551069 PRIVMSG #esolangs :14[[07Talk:14]]4 N10 02https://esolangs.org/w/index.php?oldid=150309 5* 03Aadenboy 5* (+361) 10Created page with "this reminds me of my esolang, [[Kawa]], with the character radical aspect ~~~~"
> 1737152144 796029 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150310&oldid=150280 5* 03Aadenboy 5* (+4) 10/* XKCD Random Number */ shouldn't there be a zero on the stack first?
< 1737153724 141288 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :What are the query parameters for pagination in GitHub and what are the parameters for sending a new issue and a comment of a issue?
< 1737154117 760461 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737154704 181090 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737155152 981859 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737155545 79926 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737156837 149861 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737157247 167112 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1737157260 528379 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1737157283 733225 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737158567 211604 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1737158626 593941 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
> 1737159535 386126 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150311&oldid=150279 5* 03Ashli Katt 5* (+72) 10Clarify discard pile order
< 1737159974 430157 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam
< 1737160958 949223 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737161741 923126 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737162126 113250 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737163535 363038 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737163664 45152 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150312&oldid=150310 5* 03PrySigneToFry 5* (+42) 10
> 1737163801 207076 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150313&oldid=150301 5* 03PrySigneToFry 5* (+15) 10/* X */
< 1737163933 944458 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737163959 69318 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737164064 881336 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150314&oldid=150312 5* 03PrySigneToFry 5* (+895) 10
< 1737164574 368577 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737164601 188766 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737164659 115151 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737164685 48839 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737164937 720769 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150315&oldid=150294 5* 03PrySigneToFry 5* (+505) 10
> 1737165038 747588 PRIVMSG #esolangs :14[[07Translated SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150316&oldid=146568 5* 03PrySigneToFry 5* (+9) 10
< 1737167276 183785 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737167304 166798 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737167354 319700 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737168486 725382 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150317&oldid=150314 5* 03YufangTSTSU 5* (-8) 10i sink belongs to
> 1737168683 86762 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150318&oldid=150315 5* 03PrySigneToFry 5* (+1218) 10
> 1737169299 389041 PRIVMSG #esolangs :14[[07User:Jan jelo/BF interpreter in Thue14]]4 N10 02https://esolangs.org/w/index.php?oldid=150319 5* 03Jan jelo 5* (+4668) 10Created page with "This is a [[Brainfuck]] interpreter in [[Thue]] by [[User:Jan jelo]] (input and output are unary numbers(each output wrapped by ( and )),the value of each cell is an unbounded natural number) {0>}+::=+{0>} {
> 1737169507 353536 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150320&oldid=150215 5* 03Jan jelo 5* (+43) 10/* External resources */
< 1737170736 80103 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity
> 1737171387 649286 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150321&oldid=149942 5* 03PrySigneToFry 5* (+1110) 10/* Make it even scarier !!!! */ new section
> 1737171468 299149 PRIVMSG #esolangs :14[[07Bespoke14]]4 10 02https://esolangs.org/w/index.php?diff=150322&oldid=150304 5* 03WinslowJosiah 5* (+141) 10Update instructions list to reflect CONTROL OTHERWISE
> 1737171530 478885 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150323&oldid=150321 5* 03PrySigneToFry 5* (+107) 10
< 1737171640 895889 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737172158 786352 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (nonalphabetic and A)14]]4 10 02https://esolangs.org/w/index.php?diff=150324&oldid=144394 5* 03PrySigneToFry 5* (+272) 10/* */
< 1737172511 793503 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172540 84369 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172574 777562 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172600 76812 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172606 512600 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172672 94649 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172675 777650 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172752 54913 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737173619 363587 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737174683 525753 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticSwap.png10]]": Ring
> 1737174701 187199 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150326&oldid=149864 5* 03Aadenboy 5* (+135) 10new command
< 1737176353 925411 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737176431 924620 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737177293 568443 PRIVMSG #esolangs :14[[07(-)14]]4 N10 02https://esolangs.org/w/index.php?oldid=150327 5* 03Yayimhere2(school) 5* (+1000) 10Created page with "{{wrongtitle|title=<->}} '''<->''' is an esolang about swapping text == syntax == an expression is evaluated right from left * -"''x''""''y''" swaps the order of string x and string y * <"''x''" delete the < and return an expression where its "''x''""''x''" so fo
> 1737177376 329960 PRIVMSG #esolangs :14[[07(-)14]]4 10 02https://esolangs.org/w/index.php?diff=150328&oldid=150327 5* 03Yayimhere2(school) 5* (+90) 10
< 1737177503 901000 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737177542 519032 PRIVMSG #esolangs :14[[07(-)14]]4 10 02https://esolangs.org/w/index.php?diff=150329&oldid=150328 5* 03Yayimhere2(school) 5* (+17) 10/* syntax */
< 1737177579 976274 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737178355 906064 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150330&oldid=141686 5* 03Timwi 5* (+21) 10
> 1737180622 849060 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150331&oldid=150317 5* 03YufangTSTSU 5* (+493) 10
> 1737181244 897457 PRIVMSG #esolangs :14[[07Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;14]]4 N10 02https://esolangs.org/w/index.php?oldid=150332 5* 03Yayimhere2(school) 5* (+289) 10Created page with "this makes no sense and also isn't Turing complete cuz its impossible to run the brainfuck code on the website. its also uncomputable cuz access isn't described well enough @~~~~"
< 1737183150 665945 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za JOIN #esolangs * :[https://web.libera.chat] yayimhere
< 1737183372 815943 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :i had this idea. we're the commands only are "unlocked" by using other commands. like where you need to use commands and then it unlocks a new command and so on. but is this really possible and could this be made interesting?
< 1737183789 329952 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Sure. For example, in Python, the command `math.sin()` is "unlocked" by `import math`.
< 1737184363 222032 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true(though its not interesting or really a gimmick)
< 1737184639 577335 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :There are systems called "spellservers". In a spellserver, the way to "unlock" a command is with a cryptographic key or something else that's similarly hard to get.
> 1737184667 370123 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150333&oldid=150331 5* 03YufangTSTSU 5* (+280) 10
< 1737184673 488386 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Brian Warner's writeup is still great; he describes what are known as Warner-style spellservers: https://www.lothar.com/blog/58-The-Spellserver/
< 1737184738 656753 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :welp seems its already done
< 1737184740 42308 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :sad
< 1737184826 998928 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :time to come up with a new idea
< 1737184957 580717 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Is that really all you care about?
< 1737184985 883191 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185040 996531 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :ive had comments that my esolangs are unoriginal
< 1737185060 88384 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :so im trying to make smth that unique
< 1737185062 973676 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185069 398385 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185146 944443 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185148 526328 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :for once
< 1737185153 319150 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :dang its hard tho
< 1737185248 799719 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Well, yeah. Nothing's really unique or original, right? Everything we make is built from prior designs.
< 1737185286 33989 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true
< 1737185296 298710 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :but at least make smth slightly unique
< 1737185296 558717 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :You know those stories about Mozart or other child geniuses? They're usually exaggerated. Here's one common exaggeration: Mozart didn't actually write any of the melodies that he's credited with as a child.
< 1737185309 710486 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :lol
< 1737185346 331210 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :No, really. Or, in English, we have the legend of Shakespeare. But Shakespeare didn't actually write any of the plots to his stories; he borrowed them from other stories.
< 1737185346 391846 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :makes sense they are
< 1737185353 485098 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :never heard of them tho
< 1737185357 667327 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :(Or much more recently, Disney.)
< 1737185373 761604 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :well Disney is Disney lol
< 1737185391 807690 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :this reminds me of that one doctor who book series
< 1737185400 497511 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :thats literally just stolen plots
< 1737185401 519666 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :well
< 1737185405 163468 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :not really
< 1737185415 18920 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :its like the point of it
< 1737185465 225549 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :anywayn that gave me an idea/concept
< 1737185490 197381 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :a esolang where the programs kinda steal contents from each other
< 1737185493 42869 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185502 312465 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :like if one program solves smth
< 1737185510 286191 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :then another could steal that result
< 1737185517 100343 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :but you don't have control over it
< 1737185546 963593 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Sure, go for it.
< 1737185569 437114 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185581 996219 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :FWIW actually *building* a spellserver is non-trivial. Note that Warner doesn't actually give one, nor explain its details; he just says that if somebody implements a language like E, then they could probably try to write a spellserver too.
< 1737185593 57757 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :is there anything like this? or slightly like it(this is more to get insperation, and help cuz I have no idea how to do it))
< 1737185616 692675 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185647 915430 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :https://github.com/monte-language/typhon/blob/master/mast/tools/spellserver.mt.md Anyway, I implemented a language like E, and then I wrote a spellserver.
< 1737185668 265570 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :yayimhere: This is why int-e and I push you to learn to code; actually *implementing the idea* is what is hard and impressive. Anybody can have ideas.
< 1737185681 137431 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true
< 1737185686 436542 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :btw im learning prolog:O
< 1737185689 16589 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :*:)
< 1737185693 394932 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185706 982513 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :lol i typoed it to a :O
< 1737185707 483090 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :me dum dum lol'
< 1737185712 168970 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Fun! I'm glad that you're learning.
< 1737185731 611891 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :afterwards its minikanren and then lisp
< 1737185756 267172 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185815 883002 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :my concentration is constantly stolen from v leaving and coming back to the server wow
< 1737185831 154395 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737185852 343079 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150334&oldid=150333 5* 03PrySigneToFry 5* (+217) 10
> 1737185905 317743 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150335&oldid=150334 5* 03PrySigneToFry 5* (+29) 10
< 1737185928 911328 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :anyway bye
< 1737185932 328115 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za QUIT :Quit: Client closed
< 1737186002 261215 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186078 151996 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186155 381505 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186232 157640 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186233 977826 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186312 192488 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186321 13551 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186397 951360 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187246 583957 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737187318 943139 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187396 72818 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187405 700884 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187481 100828 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187481 437551 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187557 66448 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187603 214231 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187680 677596 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187682 823466 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187759 650732 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187762 212409 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187839 690900 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187839 960327 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187916 624602 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187922 75414 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187999 701240 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737188061 589378 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737188078 382388 PRIVMSG #esolangs :14[[07Talk:Semi-serious language list14]]4 N10 02https://esolangs.org/w/index.php?oldid=150336 5* 03Yayimhere2(school) 5* (+205) 10Created page with "tbh this with the number of restraints should be called the "ultra serious" lang list... @~~~~"
< 1737188137 649993 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737188409 293495 PRIVMSG #esolangs :14[[07AsciiDots14]]4 M10 02https://esolangs.org/w/index.php?diff=150337&oldid=150297 5* 03Piet; 5* (+68) 10Credits
< 1737188788 940263 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737188864 69225 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737188873 302130 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189029 119688 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189069 131281 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189145 141623 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189197 258845 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189272 71528 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737189334 997563 PRIVMSG #esolangs :14[[07Talk:AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150338&oldid=134806 5* 03Piet; 5* (+303) 10Bug
< 1737189375 111864 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189450 53333 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189520 578383 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189596 198465 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189649 67793 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189728 282935 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189788 169743 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189860 832020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737189863 987976 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189891 847664 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189968 107720 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190131 805168 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190204 994324 :Guest9464!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737190265 328888 :Guest9464!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737190340 410596 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190352 13628 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190366 554042 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737190446 486879 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190461 984140 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190537 988829 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190557 436328 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190634 911237 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190644 413240 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737190720 41876 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150339&oldid=150335 5* 03YufangTSTSU 5* (+0) 10please check nop please check nop please check nop please check nop
< 1737190720 987461 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190769 434660 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190845 396863 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190895 904055 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190972 388569 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191023 296027 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191104 704531 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191107 18015 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191183 464837 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191198 56414 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191273 399089 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191312 204398 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191388 932235 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191435 728989 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191511 908965 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191587 150815 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191662 929762 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191670 341146 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191746 513248 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737192096 299733 PRIVMSG #esolangs :14[[07User:UrnEn/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=150340&oldid=148603 5* 03UrnEn 5* (+6325) 10
< 1737192573 785440 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192650 66004 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192657 377246 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192732 84440 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192736 357257 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192812 60896 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192915 172264 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192991 58372 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193494 260597 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193570 17050 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193570 741260 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193646 979865 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193647 861559 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193723 783301 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193781 251082 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193863 825312 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193864 409483 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193937 121785 :Guest8686!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737194400 797947 :Guest8686!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737194477 387565 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194488 164282 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194561 983527 :Guest3889!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737194595 841998 :Guest3889!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737194679 870550 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194683 84870 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194759 607443 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194763 907413 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194844 63384 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194845 534561 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194924 39410 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194994 40223 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195070 683624 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195116 526735 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195192 654112 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195199 309356 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195275 144793 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195281 343885 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195365 513464 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195394 490991 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195471 688659 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195478 171384 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737197480 665107 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 N10 02https://esolangs.org/w/index.php?oldid=150341 5* 03Piet; 5* (+181) 10Heard this just now
< 1737198897 940563 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737199407 796920 PRIVMSG #esolangs :14[[07Semi-serious language list14]]4 10 02https://esolangs.org/w/index.php?diff=150342&oldid=149826 5* 03None1 5* (+10) 10/* Non-alphabetic */
< 1737199513 136812 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737202129 391808 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737202451 69188 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737206790 475549 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737208447 611199 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737209174 424158 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737210037 64722 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210042 318857 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210204 286635 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210210 82104 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210293 80817 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210301 326991 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210382 77672 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210395 76704 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210631 65930 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210634 821395 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210672 485199 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds
< 1737210751 60695 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210754 382940 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210833 85652 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210833 704395 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210915 294578 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210922 998437 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210947 469205 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737211007 891117 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211008 953866 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737211086 235647 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211089 968498 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737211360 448428 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737211524 19945 :mtm_!~textual@47.202.75.129 QUIT :Ping timeout: 245 seconds
< 1737211909 7444 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211910 300284 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737214303 138353 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737215651 129416 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737217354 94169 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737217683 926721 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737217705 54243 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737218328 675642 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737218491 298379 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Client Quit
< 1737218645 648939 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737220627 781648 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737222082 23055 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150343&oldid=150286 5* 03PkmnQ 5* (+317) 10/* Examples */ Add Binary lambda calculus
< 1737222237 880558 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737222736 479938 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737223230 186870 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737225697 197113 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds
< 1737225700 666269 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737225880 694569 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737227233 439001 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150344&oldid=150326 5* 03Aadenboy 5* (+72) 10/* Example Programs */
< 1737227285 105652 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
> 1737227621 858483 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaFibonacci.png10]]": split into two lines, update to match newer changers
> 1737227680 607604 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaHelloWorld.png10]]": split into three lines
> 1737227804 61076 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 N10 02https://esolangs.org/w/index.php?oldid=150347 5* 03Aadenboy 5* (+1417) 10raw programs
> 1737227896 402226 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaJumps.png10]]": diacritic indicators
> 1737227923 73180 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150349&oldid=150344 5* 03Aadenboy 5* (+18) 10/* Bases */
> 1737228010 760422 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticFlags.png10]]": All the flag diacritics
> 1737228018 691620 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150351&oldid=150349 5* 03Aadenboy 5* (+54) 10/* Diacritics */ flags
> 1737228084 358279 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaTruthMachine.png10]]": add flag
< 1737231818 113968 :molson!~molson@2605-4A80-2101-99D0-2336-79DF-71EA-5489-dynamic.midco.net JOIN #esolangs molson :realname
< 1737232069 411524 :molson_!~molson@2605-4A80-2101-99D0-4EAD-E7D9-1255-7D90-dynamic.midco.net QUIT :Ping timeout: 260 seconds
< 1737232538 112904 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1737232785 32851 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737233910 628892 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaBrainfuckImplementation.png10]]": [[Brainfuck]] implemented in [[Kawa]]
> 1737233995 754134 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150354&oldid=150351 5* 03Aadenboy 5* (+165) 10/* Example Programs */ implemented [[brainfuck]]
> 1737234009 480781 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150355&oldid=150354 5* 03Aadenboy 5* (+1) 10/* brainfuck implementation */ damn newline!
> 1737234162 809880 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Dan422442 5* 10New user account
> 1737234316 5256 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 10 02https://esolangs.org/w/index.php?diff=150356&oldid=150347 5* 03Aadenboy 5* (+2485) 10add [[File:KawaBrainfuckImplementation.png|brainfuck implementation]]
> 1737234751 989460 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 M10 02https://esolangs.org/w/index.php?diff=150357&oldid=150356 5* 03Aadenboy 5* (+18) 10
< 1737235627 403325 :Ae!Ae@linux.touz.org QUIT :Killed (NickServ (GHOST command used by ae2!thelounge@user/ae))
< 1737235636 473812 :Ae!Ae@linux.touz.org JOIN #esolangs * :Ae
< 1737235640 215974 :Ae!Ae@linux.touz.org NICK :Guest6479
< 1737235745 562871 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737236651 242582 PRIVMSG #esolangs :14[[07Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;14]]4 M10 02https://esolangs.org/w/index.php?diff=150358&oldid=150332 5* 03Aadenboy 5* (+319) 10
> 1737237580 142450 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150359&oldid=150248 5* 03Jan jelo 5* (+101) 10/* Thue */
> 1737240476 485320 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150360&oldid=150343 5* 03Blashyrkh 5* (+1232) 10Lazy K example
> 1737240766 88023 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150361&oldid=150360 5* 03Blashyrkh 5* (+60) 10
< 1737241794 842674 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1737242615 474564 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737243618 292369 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737244026 417750 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150362&oldid=150361 5* 03Jan jelo 5* (+97) 10/* Python 3 */
< 1737244970 517034 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737245168 484947 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1737245182 506885 :slavfox!~slavfox@193.28.84.183 QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1737245205 326880 :slavfox!~slavfox@193.28.84.183 JOIN #esolangs slavfox :slavfox
> 1737245837 725333 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150363&oldid=150362 5* 03Jan jelo 5* (+473) 10
> 1737246149 547840 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150364&oldid=150320 5* 03Jan jelo 5* (+520) 10/* Sample programs */
> 1737246201 682036 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150365&oldid=150364 5* 03Jan jelo 5* (+0) 10/* Sample programs */
> 1737246716 561286 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150366&oldid=150365 5* 03Jan jelo 5* (-32) 10/* Sample programs */
< 1737246817 548153 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
> 1737246832 874103 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150367&oldid=150363 5* 03Jan jelo 5* (-31) 10/* Thue */
< 1737249811 571504 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Quit: Client closed
< 1737253262 554967 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737254215 438659 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737255176 393503 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150368&oldid=150277 5* 03MihaiEso 5* (+50) 10
> 1737255750 557679 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 N10 02https://esolangs.org/w/index.php?oldid=150369 5* 03MihaiEso 5* (+1102) 10Created page with "1. Take that [[Translated /PSTF Again4|]].
2. Buy a Windows XP computer and install games on it and game for 24/7 straight. Lastly, destroy the computer, add 100000000000000 kilograms of washing machine and chi..."
< 1737255903 153589 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1737255933 111941 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
> 1737256230 916744 PRIVMSG #esolangs :14[[07Obfunge14]]4 N10 02https://esolangs.org/w/index.php?oldid=150370 5* 03None1 5* (+3033) 10Created page with "'''Obfunge''' is a [[Befunge]]-93 derivative invented by [[User:None1]], it is Befunge-93 but obfuscated. ==Instructions== Befunge-93 has the following commands: {| class="wikitable" !Cmd !Description |- |! |Addition: Pop two values a and b, then push the r
> 1737261176 358626 PRIVMSG #esolangs :14[[07Obfunge14]]4 M10 02https://esolangs.org/w/index.php?diff=150371&oldid=150370 5* 03Calculus is fun 5* (-1) 10Fixed typo of "Decryption"
> 1737262580 570466 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150372&oldid=150367 5* 03Calculus is fun 5* (+246) 10Added MoreMathRPN example
> 1737262647 270840 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150373&oldid=150273 5* 03Calculus is fun 5* (+55) 10/* Examples elsewhere on this site */
> 1737262971 899934 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150374&oldid=150372 5* 03Calculus is fun 5* (+29) 10/* MoreMathRPN */
> 1737263526 556207 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 10 02https://esolangs.org/w/index.php?diff=150375&oldid=150225 5* 03WinslowJosiah 5* (+302) 10Correction/addition for Bespoke
> 1737264278 673423 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=150376&oldid=150271 5* 03Calculus is fun 5* (-20) 10Removed people tag
> 1737269956 982156 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150377&oldid=150355 5* 03Aadenboy 5* (+27) 10
< 1737270188 67262 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737270260 819827 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
> 1737270290 696457 PRIVMSG #esolangs :14[[07User:UrnEn/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=150378&oldid=150340 5* 03UrnEn 5* (+0) 10/* 99 Bottles of Beer in something like Tokipona */
> 1737270617 824937 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150379&oldid=150274 5* 03Aadenboy 5* (-20) 10300!
> 1737271328 719531 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150380&oldid=150341 5* 03UrnEn 5* (+151) 10
> 1737272170 882872 PRIVMSG #esolangs :14[[07OISC14]]4 M10 02https://esolangs.org/w/index.php?diff=150381&oldid=148981 5* 03Tomhe 5* (+58) 10/* External resources */
< 1737272759 476643 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection
< 1737272817 173842 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737273576 455496 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737276283 812387 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737276731 2269 PRIVMSG #esolangs :14[[07Talk:SendStuff14]]4 M10 02https://esolangs.org/w/index.php?diff=150382&oldid=20017 5* 03Calculus is fun 5* (+205) 10Question
> 1737277736 808558 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150383&oldid=150374 5* 03PkmnQ 5* (+900) 10/* Binary lambda calculus */ Reformat program, add breakdown
< 1737278166 300864 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1737278221 118501 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737279726 972537 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Pantuga 5* 10New user account
> 1737280070 513417 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150384&oldid=150383 5* 03Jan jelo 5* (+308) 10/* Examples */
> 1737280353 893789 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150385&oldid=150239 5* 03Pantuga 5* (+163) 10/* Introductions */
> 1737281790 62219 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150386&oldid=150223 5* 03Jan jelo 5* (+42) 10/* Intepreters */
> 1737281991 605607 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 10 02https://esolangs.org/w/index.php?diff=150387&oldid=148766 5* 03Jan jelo 5* (+4635) 10/* Standard */
< 1737283450 28041 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737285471 166338 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737285599 583492 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1737286109 221102 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150388&oldid=150195 5* 03Kevidryon2 5* (+27) 10Added tree-based category
< 1737288174 453776 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1737288336 476271 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737288427 248020 PRIVMSG #esolangs :14[[07Translated /PSTF Again514]]4 N10 02https://esolangs.org/w/index.php?oldid=150389 5* 03PrySigneToFry 5* (+5179) 10Created page with "[[Translated /Mihai Again2|Warning: Your system is corrupted. It can't be trustfEfD?H?H?uHEfD??z ?L? SUVWH?3=??H??Gx4HH$h1 H?uf?^?f?^??Hf??_^][?L? SVWH..."
> 1737288463 613899 PRIVMSG #esolangs :14[[07Translated /PSTF Again514]]4 10 02https://esolangs.org/w/index.php?diff=150390&oldid=150389 5* 03PrySigneToFry 5* (+58) 10
> 1737288620 174121 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 10 02https://esolangs.org/w/index.php?diff=150391&oldid=150369 5* 03PrySigneToFry 5* (+86) 10
> 1737289857 728061 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 10 02https://esolangs.org/w/index.php?diff=150392&oldid=150380 5* 03Piet; 5* (+228) 10Reply
> 1737289889 750035 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150393&oldid=150392 5* 03Piet; 5* (+4) 10
> 1737289910 210298 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150394&oldid=150393 5* 03Piet; 5* (+0) 10
> 1737290019 17691 PRIVMSG #esolangs :14[[07OISC14]]4 10 02https://esolangs.org/w/index.php?diff=150395&oldid=150381 5* 03Piet; 5* (+13) 10
< 1737291974 896871 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737292055 87661 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737295929 922915 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150396&oldid=150018 5* 03ClearLimediWater 5* (+1393) 10
< 1737297156 865888 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737298482 982093 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737302220 875514 PRIVMSG #esolangs :14[[07Joke language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150397&oldid=149951 5* 03TheCanon2 5* (+29) 10/* Example-based languages */
< 1737302527 520550 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737303863 279319 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737304395 805624 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150398&oldid=144784 5* 03TheCanon2 5* (+42) 10Igblan doesn't appear to exist anymore.
> 1737304547 644796 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150399&oldid=150398 5* 03TheCanon2 5* (+2) 10
> 1737304765 908127 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150400&oldid=150399 5* 03TheCanon2 5* (-1) 10used incorrect link
> 1737306461 167371 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 10 02https://esolangs.org/w/index.php?diff=150401&oldid=150391 5* 03MihaiEso 5* (+10) 10
> 1737306592 24269 PRIVMSG #esolangs :14[[07Short Minsky Machine Notation14]]4 M10 02https://esolangs.org/w/index.php?diff=150402&oldid=136693 5* 03TheCanon2 5* (+110) 10
< 1737308848 992436 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737308993 931734 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=150403&oldid=150068 5* 03TheCanon2 5* (-4) 10Or++ Turing completeness disproven
> 1737309086 209407 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=150404 5* 03Calculus is fun 5* (+2810) 10Added MoreMathRPN/brainfuck
> 1737309348 93458 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150405&oldid=150373 5* 03Calculus is fun 5* (+153) 10Brainfuck interpreter
> 1737309401 232667 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=150406&oldid=150404 5* 03Calculus is fun 5* (+12) 10Changed back location
> 1737309610 379225 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=150407&oldid=150406 5* 03Calculus is fun 5* (+111) 10Added footnote
> 1737309656 890551 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Calculus is fun 5* 10moved [[02MoreMathRPN/brainfuck interpreter10]] to [[MoreMathRPN/Brainfuck interpreter]]: Misspelled title
> 1737309690 712817 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150410&oldid=150405 5* 03Calculus is fun 5* (+0) 10moved link
> 1737309845 860524 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150411&oldid=150387 5* 03Calculus is fun 5* (+61) 10Added MoreMathRPN example
< 1737310004 275923 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737311913 386063 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1737312114 17594 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1737312372 83763 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1737314545 552413 PRIVMSG #esolangs :14[[07Short Minsky Machine Notation14]]4 10 02https://esolangs.org/w/index.php?diff=150412&oldid=150402 5* 0347 5* (-10) 10"" technicaly just shows text unformated
< 1737314604 246273 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :
> 1737315411 571411 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150413&oldid=150400 5* 03Aadenboy 5* (+523) 10/* Main table */ adding [[kawa]]
> 1737316167 560839 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=150414&oldid=149336 5* 0347 5* (+2) 10
> 1737316198 741927 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=150415&oldid=150414 5* 0347 5* (+31) 10
< 1737317016 715270 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737318631 920247 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737319638 356823 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737322500 226251 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1737325629 803855 :Taneb!~Taneb@runciman.hacksoc.org JOIN #esolangs Taneb :Nathan van Doorn
> 1737326973 535094 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150416&oldid=150411 5* 03Aadenboy 5* (+125) 10/* Standard */ add [[Kawa]]
< 1737328435 169955 :vyv!~vyv@76.65.7.60 JOIN #esolangs vyv :vyv verver
< 1737328529 820606 :Everything!~Everythin@195.138.86.118 QUIT :Quit: Lost terminal
< 1737329424 907485 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737329853 417359 :vyv!~vyv@76.65.7.60 QUIT :Quit: Konversation terminated!
< 1737330181 136101 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737331430 572391 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737331584 633055 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737333740 305876 PRIVMSG #esolangs :14[[07MoreMathRPN/Quine14]]4 N10 02https://esolangs.org/w/index.php?oldid=150417 5* 03Calculus is fun 5* (+2902) 10Added MoreMathRPN quines
> 1737334025 212016 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150418&oldid=150410 5* 03Calculus is fun 5* (+136) 10Quines
> 1737336467 140266 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150419&oldid=150418 5* 03Aadenboy 5* (-17) 10
< 1737336817 331016 :fowl!~fowl@user/fowl QUIT :Ping timeout: 244 seconds
< 1737338190 672334 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737339079 182146 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150420&oldid=150419 5* 03Calculus is fun 5* (+188) 10added infobox
> 1737339102 472810 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150421&oldid=150420 5* 03Calculus is fun 5* (-4) 10
> 1737340614 583641 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150422&oldid=150384 5* 03Jan jelo 5* (+537) 10/* brainfuck */
< 1737341097 185632 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Read error: Connection reset by peer
< 1737341122 391817 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
> 1737341177 570134 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150423&oldid=150422 5* 03Jan jelo 5* (+4) 10/* Muriel */
< 1737341225 50771 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Excess Flood
< 1737341243 798416 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs * :Claire Rodriguez
< 1737341319 675486 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1737343046 257441 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150424&oldid=150423 5* 03Jan jelo 5* (-21) 10/* brainfuck */
< 1737343721 68216 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Quit: Client closed
> 1737343797 572938 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150425&oldid=150424 5* 03Jan jelo 5* (+19) 10/* brainfuck */
> 1737344887 405941 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaKolakoskiSequence.png10]]": [[Kolakoski sequence]] in [[Kawa]]
> 1737344911 688802 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150427&oldid=150377 5* 03Aadenboy 5* (+67) 10/* Example Programs */ add [[Kolakoski sequence]]
> 1737344968 94302 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150428&oldid=150425 5* 03Aadenboy 5* (+114) 10/* Examples */ add [[Kawa]]
> 1737344980 914172 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150429&oldid=150428 5* 03Aadenboy 5* (+1) 10/* Kawa */ not again
> 1737345015 433329 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 M10 02https://esolangs.org/w/index.php?diff=150430&oldid=150357 5* 03Aadenboy 5* (+361) 10add [[Kolakoski sequence]]
> 1737347309 459170 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150431&oldid=150429 5* 03Jan jelo 5* (+17) 10/* Lazy K */
> 1737349806 852928 PRIVMSG #esolangs :14[[07Tiny14]]4 10 02https://esolangs.org/w/index.php?diff=150432&oldid=149685 5* 03Ron.hudson 5* (-108) 10
> 1737349932 304743 PRIVMSG #esolangs :14[[07Tiny14]]4 10 02https://esolangs.org/w/index.php?diff=150433&oldid=150432 5* 03Ron.hudson 5* (-73) 10
> 1737350156 495368 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150434&oldid=150431 5* 03Jan jelo 5* (+67) 10
< 1737350911 273190 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Excess Flood
< 1737351003 349471 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737351637 203228 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Ping timeout: 248 seconds
< 1737352012 989263 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737352254 647419 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Excess Flood
< 1737352430 319565 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737353219 110542 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737359433 86449 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737361214 300935 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 244 seconds
< 1737361320 935331 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1737361366 822063 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150435&oldid=150434 5* 03Jan jelo 5* (-8) 10/* Python 3 */
< 1737363078 130134 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737363943 845848 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737368174 268370 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737374606 271767 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1737374819 67316 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1737376030 698390 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150436&oldid=150259 5* 0347 5* (-15) 10i didn't even notice the double "!"
> 1737379361 688995 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150437&oldid=120418 5* 03BrainFuckGirl 5* (+402) 10/* Hello World! */ Added another example
> 1737379442 119831 PRIVMSG #esolangs :14[[07Mazerunner14]]4 M10 02https://esolangs.org/w/index.php?diff=150438&oldid=150437 5* 03BrainFuckGirl 5* (+1) 10/* Hello World! */ spelling mistake
> 1737379660 155470 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150439&oldid=150438 5* 03BrainFuckGirl 5* (+84) 10/* Cat */ Added example
< 1737380038 339060 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737380202 997347 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737382542 442893 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1737382688 114413 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150440&oldid=150439 5* 03BrainFuckGirl 5* (+73) 10/* Truth machine */ added example
> 1737382793 50411 PRIVMSG #esolangs :14[[07User:BrainFuckGirl14]]4 M10 02https://esolangs.org/w/index.php?diff=150441&oldid=147173 5* 03BrainFuckGirl 5* (+94) 10/* Code */
> 1737382994 296586 PRIVMSG #esolangs :14[[07User:BrainFuckGirl14]]4 M10 02https://esolangs.org/w/index.php?diff=150442&oldid=150441 5* 03BrainFuckGirl 5* (+0) 10/* Brainfuck */ spelling mistakes
> 1737383058 232611 PRIVMSG #esolangs :14[[07User:BrainFuckGirl14]]4 M10 02https://esolangs.org/w/index.php?diff=150443&oldid=150442 5* 03BrainFuckGirl 5* (+0) 10/* Code */ corrected layout
< 1737384738 227233 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737388084 495441 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 M10 02https://esolangs.org/w/index.php?diff=150444&oldid=150430 5* 03Aadenboy 5* (-177) 10/* Fibonacci sequence */ make it run forever (it quickly devolves into inf but whatever)
> 1737388089 485883 PRIVMSG #esolangs :14[[07Is14]]4 10 02https://esolangs.org/w/index.php?diff=150445&oldid=68171 5* 03Kaveh Yousefi 5* (+314) 10Adjusted the i instruction's diction, as the Is language seems to operate on separate bits, rather than bytes, reformatted and reformulated the instruction table, introduced section headers, and supplemented further page category tags.
> 1737388113 746830 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaFibonacci.png10]]": now runs forever
> 1737388150 425919 PRIVMSG #esolangs :14[[07Is14]]4 10 02https://esolangs.org/w/index.php?diff=150447&oldid=150445 5* 03Kaveh Yousefi 5* (+4459) 10Added an interpreter implementation in Common Lisp.
< 1737388662 942076 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737389619 798912 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737390134 69844 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=150448&oldid=149958 5* 03TheCanon2 5* (+17) 10Added full cat
> 1737390409 247080 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=150449&oldid=150448 5* 03TheCanon2 5* (+43) 10added EOF=-1 variant
< 1737391509 95423 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1737393185 697449 :Sgeo_!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737393214 813690 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737394387 741914 PRIVMSG #esolangs :14[[07Bake14]]4 10 02https://esolangs.org/w/index.php?diff=150450&oldid=144909 5* 0347 5* (+4) 10/* Syntax */
> 1737394404 874403 PRIVMSG #esolangs :14[[07Bake14]]4 10 02https://esolangs.org/w/index.php?diff=150451&oldid=150450 5* 0347 5* (+0) 10/* Examples */
< 1737396376 96514 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1737396716 946937 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150452&oldid=150435 5* 03Calculus is fun 5* (+333) 10/* FALSE */
< 1737398567 136431 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737398587 104994 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 265 seconds
< 1737398743 71949 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737404129 338945 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150453&oldid=149594 5* 03Dmiz 5* (+167) 10
< 1737404337 429270 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1737405019 261435 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150454&oldid=150106 5* 03Jan jelo 5* (+829) 10
> 1737405507 562703 PRIVMSG #esolangs :14[[07Snakel/Compatibility methods14]]4 10 02https://esolangs.org/w/index.php?diff=150455&oldid=150032 5* 03Ractangle 5* (-1) 10/* Ultium */
> 1737405726 143373 PRIVMSG #esolangs :14[[07Dir14]]4 10 02https://esolangs.org/w/index.php?diff=150456&oldid=149113 5* 03CCeriseGD 5* (+2956) 10documentation
< 1737408351 472358 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 246 seconds
< 1737411519 752367 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737413257 471617 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150457&oldid=150454 5* 03Jan jelo 5* (+715) 10/* Thue */
> 1737413329 945127 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150458&oldid=150457 5* 03Jan jelo 5* (-715) 10/* Thue */
> 1737413565 452307 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150459&oldid=150458 5* 03Jan jelo 5* (+101) 10/* Thue */
> 1737414402 769234 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=150460&oldid=149917 5* 03AdjectiveNounNumber 5* (-183) 10
< 1737414867 15715 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
> 1737415037 348269 PRIVMSG #esolangs :14[[07Kiwiscript14]]4 10 02https://esolangs.org/w/index.php?diff=150461&oldid=149283 5* 03AdjectiveNounNumber 5* (+75) 10/* Examples */
< 1737415093 60680 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1737415966 586417 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150462&oldid=150459 5* 03Jan jelo 5* (+66) 10/* Thue */
> 1737415981 905293 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150463&oldid=150462 5* 03Jan jelo 5* (+1) 10/* Thue */
< 1737417756 68839 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1737417998 902962 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1737421196 418612 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737422779 425653 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737422867 644538 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150464&oldid=150463 5* 03Jan jelo 5* (+245) 10/* JavaScript */
< 1737429232 265123 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1737429338 880405 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 272 seconds
< 1737429855 426017 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 246 seconds
< 1737433521 974767 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1737433598 227058 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
< 1737433615 232254 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
> 1737433663 474506 PRIVMSG #esolangs :14[[07MoreMathRPN/Quine14]]4 10 02https://esolangs.org/w/index.php?diff=150465&oldid=150417 5* 03Calculus is fun 5* (+244) 10Better explanation of quine
< 1737434305 761333 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Remote host closed the connection
< 1737434388 578204 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I had read today in library about someone invented "floating floating point" that the number of bits of exponent and fraction part can be varied.
< 1737435443 485717 :pococuranteconfi!~pococuran@user/pococuranteconfi JOIN #esolangs pococuranteconfi :realname
< 1737436958 169971 :pococuranteconfi!~pococuran@user/pococuranteconfi QUIT :Read error: Connection reset by peer
< 1737438819 418570 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, you could also have a floating-point variant where the exponent was itself a floating-point number (but the range of exponents for the exponent would not include negative numbers, as those wouldn't be useful)
< 1737439108 282535 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :It is what I thought before I had finished reading the article.
< 1737439564 400322 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :this reminds me of a number format I was thinking about, which consists of a length followed by digits, and the length is recursively written in the same format (with a special case for 1 so that the recursion has a base case)
< 1737443898 551745 :Sgeo_!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737444829 191630 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ais523, zzo38: https://logs.esolangs.org/libera-esolangs/2025-01.html#lEc
< 1737444851 617961 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :which links to https://adamscherlis.github.io/blog/iterlog-coding/
< 1737444987 793456 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, it doesn't seem very good at encoding integers
< 1737445742 399021 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ais523: for natural numbers, Amicus encodes them as the list of the lengths of runs of zeros in the binary digits of the number, where each length is represented the same way. this is nice because it's a bijection between natural numbers and lists.
< 1737445748 30266 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :https://esolangs.org/wiki/Amicus
< 1737445788 629320 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :what number does an empty list represent? 0 or 1?
< 1737445840 33605 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh, presumably 0 is [] and 1 is [0]
< 1737445846 703249 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :an empty list represents 0; 1 is represented by a list containing an empty list because there's an empty run of zeros to the right of the one digit
< 1737445865 147806 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :right, and you have one element for each 1 bit in the number
> 1737445924 894546 PRIVMSG #esolangs :14[[07Text14]]4 10 02https://esolangs.org/w/index.php?diff=150466&oldid=144969 5* 03BrainFuckGirl 5* (+31) 10/* Development of a compiler */ added compiler in ><>
< 1737446005 507233 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :this is also interesting because it gives a bijection between balanced strings (which only contain the bracketing symbols and nothing else) and natural numbers (due to the obvious bijection between balanced strings and lists)
< 1737446173 196622 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :as for the length followed by digits with the length encoded the same way, I thought I've seen that somewhere. but I just checked the ICFP 2007 task spec, and no, FUUN DNA does not use that representation. it uses a simple binary with a terminator symbol.
> 1737446303 605319 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150467&oldid=150421 5* 03Calculus is fun 5* (+109) 10Added new commands
< 1737446607 242129 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I wrote a program that outputs Amicus encodings: https://tio.run/##AT0Awv9qZWxsef//QuG5ozHhuojhuIrDn@KCrArhuLbDh@KCrMWS4bmY4oCdwrbIrsKkJOKCrOG5m@KAnP///zY0
< 1737446722 611409 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ais523: https://esolangs.org/wiki/Amycus#Implementing tells how to increment a number in the Amicus representation, zzo38 helped me figure this out long ago
< 1737446750 109185 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :so in theory you could iterate that rule to get the encodings
< 1737446866 743022 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(the first line is the encoder, the second line iterates over numbers from 0 to input-1 and prints the list readably)
< 1737447147 262664 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :the power of two thing kind of bothers me, and I wonder if you could get a better encoding by recursively applying a more tame bijection between numbers and pairs of numbers. (0) ships with such a correspondence built in, but it's not quite right, because it maps 0 itself to the pair (0, 0), and you want a mapping that excludes 0.\
> 1737447245 420742 PRIVMSG #esolangs :14[[07Meowlang14]]4 10 02https://esolangs.org/w/index.php?diff=150468&oldid=119743 5* 03BrainFuckGirl 5* (+53) 10/* Interpreters */ added categories
< 1737447399 294931 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :though the Amicus representation lets you go further, trying to apply the (0) representation recursively will end up in an infinite loop pretty early
< 1737448649 544636 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :my previous statemetn is wrong, both get stuck at omega first
< 1737449685 651322 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1737452224 277857 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737452415 790482 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150469&oldid=150318 5* 03PrySigneToFry 5* (+282) 10
< 1737452904 946952 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737454285 855630 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737454388 572792 :citrons!~citrons@alt.mondecitronne.com QUIT :Ping timeout: 252 seconds
< 1737454487 123919 :citrons!~citrons@alt.mondecitronne.com JOIN #esolangs citrons :citrons
< 1737456696 363514 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737458742 197300 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737460992 901279 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 272 seconds
< 1737461193 442720 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737461256 327141 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150470&oldid=150440 5* 03BrainFuckGirl 5* (+466) 10/* Code examples */ added Example
< 1737461892 1007 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737462117 915485 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1737463245 434741 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737463472 727064 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737464967 430003 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 246 seconds
> 1737465209 203877 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150471&oldid=150469 5* 03PrySigneToFry 5* (+996) 10
< 1737467863 184452 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737468046 546075 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150472&oldid=150467 5* 03Calculus is fun 5* (+443) 10Added new function commands!
> 1737468245 838459 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150473&oldid=150472 5* 03Calculus is fun 5* (+4) 10Fixed header hierarchy
> 1737469986 784459 PRIVMSG #esolangs :14[[07MoreMathRPN/Quine14]]4 M10 02https://esolangs.org/w/index.php?diff=150474&oldid=150465 5* 03Calculus is fun 5* (+67) 10MInor remark
> 1737470059 584355 PRIVMSG #esolangs :14[[07MoreMathRPN/Quine14]]4 M10 02https://esolangs.org/w/index.php?diff=150475&oldid=150474 5* 03Calculus is fun 5* (+2) 10
> 1737470219 688313 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150476&oldid=149566 5* 03I am islptng 5* (-88) 10
> 1737471272 897635 PRIVMSG #esolangs :14[[07UpDown14]]4 10 02https://esolangs.org/w/index.php?diff=150477&oldid=124084 5* 03IdfbAn 5* (+10) 10Distinguish variables that underflow and overflow error messages refer to
> 1737471409 981437 PRIVMSG #esolangs :14[[07UpDown14]]4 10 02https://esolangs.org/w/index.php?diff=150478&oldid=150477 5* 03IdfbAn 5* (+5) 10Make UpDown and UD++ command descriptions consistent
< 1737473543 985747 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737473800 171345 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu JOIN #esolangs b_jonas :[https://web.libera.chat] wib_jonas
< 1737473917 400870 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :ais523: I think the Jelly snippet that you gave is outputting all the lists reversed
< 1737475465 678886 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737476201 594212 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737476272 448323 PRIVMSG #esolangs :14[[07Amycus14]]4 10 02https://esolangs.org/w/index.php?diff=150479&oldid=75726 5* 03B jonas 5* (+0) 10/* Implementing */ there was one more typo in the formula
< 1737477306 472368 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1737477521 288579 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :I mean all the recursive sublists reversed to be clear
< 1737478128 498708 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu QUIT :Quit: Client closed
> 1737480947 314217 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Gotz 5* 10New user account
> 1737481220 650213 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150480&oldid=150473 5* 03Calculus is fun 5* (+14) 10minor format
< 1737481793 624691 :m5zs7k_!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737481843 228661 :Melvar!~melvar@dslb-088-070-034-244.088.070.pools.vodafone-ip.de QUIT :Ping timeout: 252 seconds
< 1737481845 315145 :jix!~jix@user/jix QUIT :Ping timeout: 248 seconds
< 1737481868 213743 :Melvar!~melvar@dslb-088-070-034-244.088.070.pools.vodafone-ip.de JOIN #esolangs Melvar :melvar
< 1737481884 753072 :m5zs7k!aquares@web10.mydevil.net QUIT :Read error: Connection reset by peer
< 1737481963 961966 :jix!~jix@user/jix JOIN #esolangs jix :Jannis Harder
< 1737482391 409480 :m5zs7k_!aquares@web10.mydevil.net NICK :m5zs7k
< 1737482948 138982 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :Quit: bye bye
< 1737483002 100858 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1737484941 468200 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737485013 142194 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1737485022 76660 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737488316 54063 PRIVMSG #esolangs :14[[07true14]]4 10 02https://esolangs.org/w/index.php?diff=150481&oldid=148975 5* 0347 5* (+39) 10/* Commands */
> 1737489663 17872 PRIVMSG #esolangs :14[[07Vfl14]]4 10 02https://esolangs.org/w/index.php?diff=150482&oldid=130893 5* 0347 5* (+69) 10/* External links */
> 1737489679 549707 PRIVMSG #esolangs :14[[07Vfl14]]4 10 02https://esolangs.org/w/index.php?diff=150483&oldid=150482 5* 0347 5* (+0) 10/* External links */
< 1737490834 63418 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
> 1737491511 915846 PRIVMSG #esolangs :14[[07Nopstacle14]]4 10 02https://esolangs.org/w/index.php?diff=150484&oldid=148737 5* 03Ais523 5* (-5) 10Undo revision [[Special:Diff/148737|148737]] by [[Special:Contributions/Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff|Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]] ([[User talk:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffff
> 1737492116 371825 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150485&oldid=150480 5* 03Calculus is fun 5* (+365) 10Added inputSE
< 1737493423 142709 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1737494909 629991 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737494979 79804 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150486&oldid=150464 5* 03Jan jelo 5* (+119) 10
> 1737495053 938327 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150487&oldid=150486 5* 03Jan jelo 5* (+0) 10/* Smalltalk */
> 1737495259 7597 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150488&oldid=150487 5* 03Jan jelo 5* (+29) 10/* Uiua */
> 1737495668 946519 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150489&oldid=150485 5* 03Calculus is fun 5* (+228) 10Added function example
> 1737496228 430431 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150490&oldid=150488 5* 03Jan jelo 5* (+33) 10/* Uiua */
> 1737497664 400207 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150491&oldid=150489 5* 03Calculus is fun 5* (+118) 10/* Using run */
< 1737500480 303182 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737501631 968753 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737501917 305586 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1737502857 409322 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Somefan 5* 10New user account
< 1737503720 697153 :somefan!~somefan@208.58.192.69 JOIN #esolangs * :[https://web.libera.chat] somefan
< 1737504000 579644 :somefan!~somefan@208.58.192.69 QUIT :Client Quit
< 1737504229 477055 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1737504412 647082 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1737504548 338189 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150492&oldid=150385 5* 03Somefan 5* (+162) 10
> 1737504562 840639 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150493&oldid=150492 5* 03Somefan 5* (+83) 10
> 1737504692 395906 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150494&oldid=150493 5* 03Somefan 5* (+1) 10
> 1737505096 14968 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150495&oldid=150490 5* 03Jan jelo 5* (+83) 10/* Deadfish++ */
> 1737505422 110868 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150496&oldid=150495 5* 03Jan jelo 5* (-1) 10/* Desmos */
> 1737506021 736351 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150497&oldid=150496 5* 03Jan jelo 5* (-25) 10/* Smalltalk */
> 1737506914 436470 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150498&oldid=150497 5* 03Jan jelo 5* (+50) 10/* Bash */
> 1737511065 561737 PRIVMSG #esolangs :14[[07true14]]4 10 02https://esolangs.org/w/index.php?diff=150499&oldid=150481 5* 03Somefan 5* (+25) 10
> 1737511165 82368 PRIVMSG #esolangs :14[[07true14]]4 10 02https://esolangs.org/w/index.php?diff=150500&oldid=150499 5* 03Somefan 5* (+48) 10
> 1737511523 555003 PRIVMSG #esolangs :14[[07User:Somefan14]]4 N10 02https://esolangs.org/w/index.php?oldid=150501 5* 03Somefan 5* (+242) 10Created page with "{{lowercase}} Hi, my name is '''Fan0102''', '''Fan''', and '''SomeFan''' simultaneously, although I prefer the last two. [https://somefan0102.neocities.org here is my website]
"
> 1737512494 564721 PRIVMSG #esolangs :14[[07Iterate14]]4 N10 02https://esolangs.org/w/index.php?oldid=150502 5* 03Aadenboy 5* (+2418) 10Created page with "{{Distinguish/Confusion|Iterate}} Iterate is a program by [[User:Aadenboy]] which only uses iterative loops. == Syntax == === Loops === Loops are initialized with an asterisk (optionally with a number preceding it surrounded by parentheses), followed by the amount of
> 1737512523 570158 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150503&oldid=150379 5* 03Aadenboy 5* (+54) 10/* who. who are you */ add [[Iterate]]
> 1737512558 700615 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150504&oldid=150313 5* 03Aadenboy 5* (+14) 10/* I */ add [[Iterate]]
> 1737512705 628365 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150505&oldid=150502 5* 03Aadenboy 5* (+123) 10/* Examples */ [[Truth-machine]]
> 1737512764 492746 PRIVMSG #esolangs :14[[07User talk:Somefan14]]4 N10 02https://esolangs.org/w/index.php?oldid=150506 5* 03Aadenboy 5* (+324) 10Created page with "well I didn't expect to see you here! ~~~~"
> 1737513180 660130 PRIVMSG #esolangs :14[[07User talk:Somefan14]]4 10 02https://esolangs.org/w/index.php?diff=150507&oldid=150506 5* 03Somefan 5* (+232) 10
> 1737513356 108366 PRIVMSG #esolangs :14[[07User talk:Somefan14]]4 10 02https://esolangs.org/w/index.php?diff=150508&oldid=150507 5* 03Aadenboy 5* (+298) 10
< 1737514248 83555 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737515761 562475 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150509&oldid=143784 5* 03WoodyFan3412 5* (+204) 10Added JavaScript Implementation
> 1737516381 513140 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150510&oldid=150498 5* 03Jan jelo 5* (+0) 10/* Desmos */
> 1737518182 942657 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150511&oldid=150510 5* 03Aadenboy 5* (+422) 10add [[Iterate]], [[Kawa]], [[MEMORYLEEK]] and [[Trampolines]]
< 1737518737 281517 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737519868 170113 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150512&oldid=150491 5* 03Calculus is fun 5* (+423) 10/* Ackermann function */
> 1737523133 775253 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150513&oldid=150242 5* 03Jan jelo 5* (+85) 10/* Uiua */
> 1737524104 645940 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150514&oldid=150505 5* 03Aadenboy 5* (+92) 10/* Completeness */ Iterate might not be Turing complete
> 1737524146 792980 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150515&oldid=150514 5* 03Aadenboy 5* (+0) 10fix distinguish link
> 1737524175 130804 PRIVMSG #esolangs :14[[07ITERATE14]]4 M10 02https://esolangs.org/w/index.php?diff=150516&oldid=118406 5* 03Aadenboy 5* (+34) 10distinguish
< 1737525875 364293 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737526437 873318 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150517&oldid=149671 5* 03DGCK81LNN 5* (+268) 10
> 1737526749 988844 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150518&oldid=150517 5* 03DGCK81LNN 5* (+7) 10/* Koishi runtime specific */
> 1737526804 665736 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150519&oldid=150518 5* 03DGCK81LNN 5* (-2) 10/* Example programs */
> 1737526945 71207 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150520&oldid=150513 5* 03Jan jelo 5* (+98) 10/* WhatLang */
> 1737527389 388859 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150521&oldid=150520 5* 03Jan jelo 5* (+86) 10/* WhatLang */
> 1737528903 104491 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150522&oldid=150521 5* 03Jan jelo 5* (+83) 10/* Uiua */
< 1737532227 547144 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737532333 874152 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150523&oldid=150470 5* 03BrainFuckGirl 5* (+349) 10/* Code examples */ added Disan Count example
> 1737533243 518935 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150524&oldid=150509 5* 0347 5* (+95) 10/* Python 3 */
> 1737533309 923598 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150525&oldid=150524 5* 0347 5* (+1) 10/* Python 3 */
> 1737533474 778641 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150526&oldid=150525 5* 0347 5* (-1) 10/* Python 3 */
> 1737533518 121362 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150527&oldid=150526 5* 0347 5* (-2) 10/* Python 3 */
< 1737533556 663060 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1737533671 158864 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737534424 488511 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737540928 938414 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737543163 415277 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150528&oldid=150471 5* 03PrySigneToFry 5* (+15) 10
> 1737543850 160287 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150529&oldid=150528 5* 03PrySigneToFry 5* (+758) 10
< 1737544442 484645 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1737546470 475732 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 244 seconds
< 1737546767 81832 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737547419 490950 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1737547552 299507 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737547701 844792 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737548810 922373 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 272 seconds
< 1737549102 639018 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737549144 164643 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737549161 695075 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737549654 44661 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03(()()) 5* 10New user account
> 1737549813 354046 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=150530&oldid=150494 5* 03(()()) 5* (+109) 10added myself
< 1737550603 261734 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737550866 745948 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150531&oldid=150529 5* 03PrySigneToFry 5* (+1482) 10
> 1737551372 907282 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150532&oldid=150531 5* 03PrySigneToFry 5* (+412) 10
> 1737551484 719350 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150533&oldid=150530 5* 03(()()) 5* (+0) 10
> 1737552027 659895 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150534&oldid=150323 5* 03PrySigneToFry 5* (+990) 10
< 1737552091 392747 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737552144 147743 PRIVMSG #esolangs :14[[07X-Script14]]4 N10 02https://esolangs.org/w/index.php?oldid=150535 5* 03PrySigneToFry 5* (+175) 10Created page with "This is a redirect page. If you want to learn about X-script, but you make a case mistake, you will be redirected to the correct page through this page. #REDIRECT [[X-script]]"
> 1737552162 8040 PRIVMSG #esolangs :14[[07X-Script14]]4 10 02https://esolangs.org/w/index.php?diff=150536&oldid=150535 5* 03PrySigneToFry 5* (+1) 10Redirected page to [[X-script]]
> 1737552218 908209 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150537&oldid=150532 5* 03PrySigneToFry 5* (+43) 10
> 1737552576 47366 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150538&oldid=150339 5* 03PrySigneToFry 5* (+176) 10
> 1737553470 23266 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=150539&oldid=148882 5* 03PrySigneToFry 5* (+217) 10/* Some excellent sans-serif fonts for you, by PSTF */ new section
> 1737553471 207580 PRIVMSG #esolangs :14[[07Talk:A+B Problem14]]4 N10 02https://esolangs.org/w/index.php?oldid=150540 5* 03Blashyrkh 5* (+234) 10Created page with "[[A+B Problem#Subleq]] should be considered a cheating. The language supports IO, so why don't give an example that uses all language features? --~~~~"
> 1737555530 360411 PRIVMSG #esolangs :14[[07013414]]4 10 02https://esolangs.org/w/index.php?diff=150541&oldid=136403 5* 03PrySigneToFry 5* (-1) 10Fixed command for unconfusing
< 1737556529 366801 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737556626 46592 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737556895 877241 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737557385 930089 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737558866 709056 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150542&oldid=150519 5* 03DGCK81LNN 5* (+4542) 10/* Koishi runtime specific */
< 1737560433 637059 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 244 seconds
> 1737561301 745978 PRIVMSG #esolangs :14[[07013414]]4 10 02https://esolangs.org/w/index.php?diff=150543&oldid=150541 5* 03Ractangle 5* (+1) 10oh no you don't
> 1737562269 720257 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=150544&oldid=150539 5* 03Aadenboy 5* (+405) 10
> 1737562410 297156 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaA+BProblem.png10]]": lmao I forgot to upload it
< 1737563998 981904 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1737564170 151798 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150546&oldid=150542 5* 03DGCK81LNN 5* (-61) 10rephrase everything about the Frame Stack
< 1737564410 471882 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 252 seconds
< 1737565869 902590 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Ugh. I have a cool idea for graphical syntax for sheaves over (psuedometric) (vector) spaces, but I don't know how to parse it.
< 1737565896 615457 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I *do* know a language that would require similar parsing, and that is implemented, and that doesn't really do much besides parsing...
< 1737565902 867271 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But Is It Art?
> 1737567305 820883 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150547&oldid=150515 5* 03Aadenboy 5* (+27) 10category
> 1737567576 215949 PRIVMSG #esolangs :14[[07Talk:Iterate14]]4 N10 02https://esolangs.org/w/index.php?oldid=150548 5* 03Aadenboy 5* (+735) 10Created page with "would there be a way to prove what computational class Iterate is? not really sure how to go about this I know it isn't a [[Finite-state automaton]] simply from this code: (*)< *=1< @ > // loops once on the second pass, then twice on the third, three times
> 1737568451 32637 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150549&oldid=150544 5* 03Aadenboy 5* (+55) 10
> 1737568535 326409 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150550&oldid=150512 5* 03Calculus is fun 5* (-4) 10/* 99 bottles of beer */
> 1737569038 889846 PRIVMSG #esolangs :14[[07Talk:Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150551&oldid=150548 5* 03Corbin 5* (+198) 10It's very funny that I keep citing this theorem; I happen to hate it.
> 1737569688 456462 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150552&oldid=150527 5* 03Ractangle 5* (-15) 10/* Python 3 */
> 1737569770 231596 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150553&oldid=150547 5* 03Aadenboy 5* (+434) 10/* Examples */ comments
> 1737570002 539118 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150554&oldid=150552 5* 03Aadenboy 5* (+240) 10add Lua
> 1737570046 121705 PRIVMSG #esolangs :14[[07InterpretMe14]]4 M10 02https://esolangs.org/w/index.php?diff=150555&oldid=150554 5* 03Aadenboy 5* (+1) 10/* Lua */
> 1737570731 804351 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150556&oldid=150546 5* 03DGCK81LNN 5* (+3954) 10
> 1737570781 463142 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150557&oldid=150556 5* 03DGCK81LNN 5* (+0) 10/* WhatNoter */
< 1737571433 231853 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737571458 440503 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 246 seconds
< 1737571609 800630 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1737572395 948841 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737573683 938301 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150558&oldid=150330 5* 03Timwi 5* (+15) 10/* Features */
> 1737573993 782086 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150559&oldid=150557 5* 03Jan jelo 5* (-20) 10/* Example programs */ wait,I can use the repr@
> 1737574236 187762 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150560&oldid=150555 5* 0347 5* (+14) 10/* Python 3 */
> 1737574488 641481 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150561&oldid=150558 5* 03Timwi 5* (+35) 10/* Problem #3: it doesnt work with negative numbers */
> 1737574603 620292 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150562&oldid=150359 5* 03Jan jelo 5* (+39) 10/* WhatLang */
> 1737574713 645505 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150563&oldid=150561 5* 03Timwi 5* (+11) 10/* Strings */
< 1737575813 770331 :somefan!~somefan@208.58.192.69 JOIN #esolangs * :[https://web.libera.chat] somefan
< 1737575841 17670 :somefan!~somefan@208.58.192.69 QUIT :Client Quit
> 1737575861 281305 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150564&oldid=150563 5* 03Timwi 5* (+0) 10/* Lazy sequences */
< 1737575973 446134 :visilii_!~visilii@213.24.126.57 JOIN #esolangs * :ZNC - https://znc.in
< 1737576178 24010 :visilii!~visilii@188.254.110.9 QUIT :Ping timeout: 248 seconds
> 1737576777 369791 PRIVMSG #esolangs :14[[07Stub14]]4 M10 02https://esolangs.org/w/index.php?diff=150565&oldid=142430 5* 03Aadenboy 5* (-35) 10what am I talking about? this isn't a brainfuck deriv!
> 1737576805 796057 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150566&oldid=150503 5* 03Aadenboy 5* (-5) 10
> 1737578163 394784 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150567&oldid=150559 5* 03Jan jelo 5* (+170) 10/* Practices and idioms */
> 1737579971 912322 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=150568&oldid=149667 5* 03Jan jelo 5* (+219) 10/* Upsilon */
> 1737580693 54697 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=150569&oldid=150568 5* 03Jan jelo 5* (+91) 10/* WhatLang */
> 1737580723 264688 PRIVMSG #esolangs :14[[07Factorial14]]4 M10 02https://esolangs.org/w/index.php?diff=150570&oldid=150569 5* 03Jan jelo 5* (+0) 10/* WhatLang */
< 1737582129 965844 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
> 1737582493 278272 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=150571&oldid=150570 5* 03Jan jelo 5* (+111) 10/* Recs */
< 1737582617 100480 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1737582770 902037 PRIVMSG #esolangs :14[[07Counterlang14]]4 10 02https://esolangs.org/w/index.php?diff=150572&oldid=123936 5* 03Kaveh Yousefi 5* (+1636) 10Supplemented an Extended Backus-Naur Form (EBNF) description of the syntax, introduced an examples section comprehending an incipial member, added a hyperlink to my implementation on GitHub, and supplied several page category tags.
> 1737583841 117181 PRIVMSG #esolangs :14[[07Recs14]]4 M10 02https://esolangs.org/w/index.php?diff=150573&oldid=149668 5* 03Jan jelo 5* (+15) 10/* Reduce */
> 1737583987 816432 PRIVMSG #esolangs :14[[07Recs14]]4 M10 02https://esolangs.org/w/index.php?diff=150574&oldid=150573 5* 03Jan jelo 5* (-2) 10/* fn */
< 1737584459 279206 :visilii!~visilii@46.61.242.99 JOIN #esolangs * :ZNC - https://znc.in
< 1737584583 430227 :visilii_!~visilii@213.24.126.57 QUIT :Ping timeout: 246 seconds
< 1737584706 301340 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Is there any name for a monad that uses a identity functor, and/or if the Kleisli category is as good as the original category? (A identity monad has both of these properties, but I mean in general, if there are any.)
< 1737584742 509949 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :"codensity monad" might be the phrase to look up.
< 1737584789 94170 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :In general, the identity functor only carries the identity monad, but sometimes there are cases where identity can be naturally transformed to/from something more interesting. Continuation monads are a fun motivating example.
< 1737585202 612956 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Can nonzero scalar multiples make monads of category of matrices? To me it seemed to do, and is with identity functor?
< 1737585259 960156 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737585310 678069 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Yes, I think so. Let K be our set of scalars and Mat(K) be the category with natural numbers for objects and matrices/linear transformations for arrows. Composition is matrix multiplication.
< 1737585377 107365 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, hm. I was going to build endofunctors, but I'm having trouble finding them. For 1 in K, there's an identity functor which scales everything by 1; but no other scalar is compatible with the functor laws.
< 1737585651 371530 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Of course the identity functor scales everything by 1, but I mean the natural transformations (eta and mu) of the monad, not the functor itself.
< 1737585826 551290 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I suppose it depends on K. Any idea where the monad's underlying adjunction might go?
< 1737585980 246187 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1737586145 345112 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=150575&oldid=150571 5* 03Jan jelo 5* (+3) 10/* WhatLang */
< 1737586445 204541 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737586472 722501 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :As far as I can tell, in this case, the Kleisli category is as good as the original category, but all of the numbers are scaled, and the components are the identity matrix multiplied or divided by a scalar, and since they are scalar that also means that they are commutative. This means that the Kleisli composition will divide by the scalar that you had originally multiplied by, in order to restore the original value.
> 1737586604 794399 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150576&oldid=150567 5* 03Jan jelo 5* (+155) 10/* Practices and idioms */
< 1737587720 617522 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Hopefully, I am not being unclear or wrong, so far)
< 1737588233 152552 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It's clear, but I'm stumped and don't know how to proceed. I feel like a linear-algebra expert would have more insight.
< 1737588298 319056 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :If the chosen scalar is invertible, then the Kleisli category would be equivalent to the original category and the functors would be "identity-on-objects", which is a concept that can't be made isomorphism-invariant.
< 1737588329 304887 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :This isn't wrong, but it is what folks call "evil", and suggests that there's some unaccounted structure in the setup.
< 1737588342 893695 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :...Which suggests that my setup is fairly wrong.
> 1737590038 999054 PRIVMSG #esolangs :14[[07Is it14]]4 10 02https://esolangs.org/w/index.php?diff=150577&oldid=128199 5* 03Somefan 5* (-4485) 10I think this would be best suited as a redirect rather then a duplicate. Do correct me if i'm wrong
< 1737590645 135653 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1737590773 904691 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737592681 774766 PRIVMSG #esolangs :14[[07Looping counter14]]4 M10 02https://esolangs.org/w/index.php?diff=150578&oldid=150562 5* 03Aadenboy 5* (+158) 10add [[Iterate]]
> 1737592748 357125 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150579&oldid=150553 5* 03Aadenboy 5* (+140) 10/* Examples */ add [[Looping counter]]
> 1737593586 533365 PRIVMSG #esolangs :14[[07Deadfish~14]]4 M10 02https://esolangs.org/w/index.php?diff=150580&oldid=139804 5* 03TheCanon2 5* (+58) 10
> 1737595626 556289 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=150581&oldid=149273 5* 03Dmiz 5* (+9) 10
> 1737595885 561606 PRIVMSG #esolangs :14[[07User:Somefan14]]4 10 02https://esolangs.org/w/index.php?diff=150582&oldid=150501 5* 03Somefan 5* (-18) 10
< 1737597078 998408 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737599227 855540 PRIVMSG #esolangs :14[[07BitTurn14]]4 10 02https://esolangs.org/w/index.php?diff=150583&oldid=150194 5* 03I am islptng 5* (+21) 10
> 1737602061 954501 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=150584&oldid=150549 5* 03PrySigneToFry 5* (+519) 10
> 1737602112 293541 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=150585&oldid=150584 5* 03PrySigneToFry 5* (+836) 10Added a signature
> 1737604430 807080 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150586&oldid=150511 5* 03Jan jelo 5* (-10) 10/* JavaScript */
> 1737604949 941261 PRIVMSG #esolangs :14[[07X-script/Examples14]]4 N10 02https://esolangs.org/w/index.php?oldid=150587 5* 03PrySigneToFry 5* (+482) 10Created page with "{{Back|X-script}} Here is some X-script example. = Hello, world! = print("Hello, world!") == By output file == print("Hello, world!", file = "test.out") # If the file doesn't exist, X-script will automatically create it. print("", end = "", file = "C
> 1737607080 610691 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 10 02https://esolangs.org/w/index.php?diff=150588&oldid=149079 5* 03Jan jelo 5* (+258) 10/* Wenyan */
> 1737607158 769984 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 M10 02https://esolangs.org/w/index.php?diff=150589&oldid=150588 5* 03Jan jelo 5* (+1) 10/* WhatLang */
> 1737608350 981209 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150590&oldid=150537 5* 03PrySigneToFry 5* (+12) 10Fixed
> 1737608783 36825 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150591&oldid=150590 5* 03PrySigneToFry 5* (+366) 10
> 1737608921 185583 PRIVMSG #esolangs :14[[07X-script/Examples14]]4 10 02https://esolangs.org/w/index.php?diff=150592&oldid=150587 5* 03PrySigneToFry 5* (+368) 10
> 1737609149 448687 PRIVMSG #esolangs :14[[07Basilisk14]]4 10 02https://esolangs.org/w/index.php?diff=150593&oldid=144822 5* 03PrySigneToFry 5* (+284) 10
> 1737609203 188867 PRIVMSG #esolangs :14[[07Talk:Basilisk14]]4 10 02https://esolangs.org/w/index.php?diff=150594&oldid=143818 5* 03PrySigneToFry 5* (+885) 10/* I think Basilisk will do nothing on APLWSI. */ new section
> 1737609253 775099 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150595&oldid=150591 5* 03PrySigneToFry 5* (+58) 10
> 1737609394 947232 PRIVMSG #esolangs :14[[07013414]]4 10 02https://esolangs.org/w/index.php?diff=150596&oldid=150543 5* 03PrySigneToFry 5* (+102) 10
> 1737609714 881340 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=150597&oldid=149922 5* 03PrySigneToFry 5* (+1097) 10/* Soft redirect */ new section
> 1737610012 347960 PRIVMSG #esolangs :14[[07Talk:SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150598&oldid=146835 5* 03PrySigneToFry 5* (+1017) 10
> 1737612996 703518 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 10 02https://esolangs.org/w/index.php?diff=150599&oldid=150589 5* 03Jan jelo 5* (+266) 10/* List of implementations (non-esolangs) */
< 1737613375 561486 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Parsing But Is It Art? is not fun. It's like the worst parts of sprite-handling routines. I seem to have more fenceposts than successfully-parsed tiles.
< 1737613538 215789 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :One interesting thing I found: I'm not sure BIIA? admits a single-pass parser. I found that I had to first lay out the program in memory as a graph-theoretic object and then run two graph traversals, first to find the bounding box of the tile and second to cut/copy the tile to its own little sprite.
< 1737613650 633695 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Doing a single unified traversal would be tricky. The bounding box isn't just for memory, but for making progress in the parse. That said, perhaps it's merely too late at night for me to see a simpler solution.
< 1737614724 413565 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 260 seconds
> 1737614844 443450 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150600&oldid=150017 5* 03PrySigneToFry 5* (+509) 10
< 1737614928 286942 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1737615074 686228 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150601&oldid=150576 5* 03DGCK81LNN 5* (+0) 10/* Instructions */
> 1737615472 424423 PRIVMSG #esolangs :14[[07Deadfish~14]]4 10 02https://esolangs.org/w/index.php?diff=150602&oldid=150580 5* 03Ractangle 5* (+17) 10Fixed a tiny thing
> 1737615666 114057 PRIVMSG #esolangs :14[[07Talk:Basilisk14]]4 10 02https://esolangs.org/w/index.php?diff=150603&oldid=150594 5* 03Ractangle 5* (+180) 10/* I think Basilisk will do nothing on APLWSI. */
< 1737617785 670548 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737621756 602165 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150604&oldid=149831 5* 03Jan jelo 5* (+123) 10/* Haskell */
> 1737622198 902220 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=150605&oldid=150604 5* 03Jan jelo 5* (+38) 10/* Uiua */
> 1737622910 979342 PRIVMSG #esolangs :14[[07InterpretMe14]]4 10 02https://esolangs.org/w/index.php?diff=150606&oldid=150560 5* 03WoodyFan3412 5* (+111) 10golfed version
< 1737623222 719419 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737623530 736364 PRIVMSG #esolangs :14[[07Talk:Basilisk14]]4 10 02https://esolangs.org/w/index.php?diff=150607&oldid=150603 5* 03PrySigneToFry 5* (+886) 10
> 1737623950 543807 PRIVMSG #esolangs :14[[07User:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150608&oldid=148897 5* 03PrySigneToFry 5* (+16) 10Fixed case-error and missing punctuations
< 1737624222 621259 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737628272 720345 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150609&oldid=150586 5* 03Jan jelo 5* (+291) 10/* JavaScript */
> 1737628309 152184 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150610&oldid=150609 5* 03Jan jelo 5* (+0) 10/* JavaScript */
< 1737628606 531282 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737633799 463950 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1737633949 902185 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1737634574 700496 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150611&oldid=150601 5* 03DGCK81LNN 5* (+311) 10
< 1737635306 203047 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1737636062 62031 PRIVMSG #esolangs :14[[07User:Jan jelo/My first BF quine14]]4 N10 02https://esolangs.org/w/index.php?oldid=150612 5* 03Jan jelo 5* (+7694) 10Created page with "This is a [[Quine]] in [[Brainfuck]] by [[User: Jan jelo]]. It contains 7575 characters. ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++>>>++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++>>>+++++++
> 1737636188 976396 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150613&oldid=150605 5* 03Jan jelo 5* (+7647) 10/* Blood32 */
> 1737636346 264638 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150614&oldid=150386 5* 03Jan jelo 5* (+37) 10/* Other */
< 1737636723 193793 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
> 1737637455 27694 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150615&oldid=150233 5* 03I am islptng 5* (+562) 10/* */
> 1737637973 467302 PRIVMSG #esolangs :14[[07Talk:SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150616&oldid=150598 5* 03I am islptng 5* (+820) 10/* Suggested commands */
< 1737638150 554168 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737640442 485918 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1737641026 191245 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737641253 982337 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737642976 440835 PRIVMSG #esolangs :14[[07NOR Machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=150617 5* 03Unname4798 5* (+428) 10Created page with "NOR Machine is an esolang made by Unname4798. == Command == Two commands only: [number] push [number]th bit of user input into the stack n pop two top bits, push NOR of two top bits After all instructions have been done, output all bits from top to bottom from
> 1737643039 150959 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150618&oldid=150210 5* 03Unname4798 5* (+33) 10
> 1737643061 433953 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150619&oldid=150618 5* 03Unname4798 5* (-3) 10
< 1737643189 442068 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737643975 299499 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150620&oldid=150453 5* 03Dmiz 5* (+0) 10
< 1737644447 176093 :Sgeo!~Sgeo@user/sgeo QUIT :*.net *.split
< 1737644447 283160 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :*.net *.split
< 1737644448 666829 :Guest6479!Ae@linux.touz.org QUIT :*.net *.split
< 1737644449 159618 :moony!moony@hellomouse/dev/moony QUIT :*.net *.split
< 1737644449 701791 :ski!~ski@remote11.chalmers.se QUIT :*.net *.split
< 1737644449 845957 :APic!apic@apic.name QUIT :*.net *.split
< 1737644745 654744 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737644745 655133 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737644745 655148 :Guest6479!Ae@linux.touz.org JOIN #esolangs * :Ae
< 1737644745 655158 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1737644745 655170 :ski!~ski@remote11.chalmers.se JOIN #esolangs ski :Stefan Ljungstrand
< 1737644745 655181 :APic!apic@apic.name JOIN #esolangs APic :A. Pic. - my name since YOLD 3149
< 1737644818 797034 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Write error: Connection reset by peer
< 1737644835 35420 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1737645682 969195 PRIVMSG #esolangs :14[[07Smasnug14]]4 N10 02https://esolangs.org/w/index.php?oldid=150621 5* 03Win7HE 5* (+593) 10Created page with "== smasnug == smasnug is created by [[User:Win7HE]] just [[HQ9+]] but with [o]utput and [i]nput and / division and [3] accumulators == the new smaooong commands == o = outputs accumulator #2 i = puts 1 character input (in decimal) in accumulator #3 / = divides accu. 1 by
> 1737645704 871314 PRIVMSG #esolangs :14[[07Smasnug14]]4 10 02https://esolangs.org/w/index.php?diff=150622&oldid=150621 5* 03Win7HE 5* (+5) 10
> 1737645847 821444 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=150623&oldid=149476 5* 03Win7HE 5* (+52) 10/* check out these */
> 1737646070 548454 PRIVMSG #esolangs :14[[07HQ9+14]]4 10 02https://esolangs.org/w/index.php?diff=150624&oldid=142700 5* 03Win7HE 5* (+34) 10/* See also */
< 1737646736 883881 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737647432 317308 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737647563 236914 PRIVMSG #esolangs :14[[07HQ9+14]]4 10 02https://esolangs.org/w/index.php?diff=150625&oldid=150624 5* 03Somefan 5* (-1) 10
> 1737649321 460280 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150626&oldid=150611 5* 03DGCK81LNN 5* (-645) 10
< 1737649714 572742 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737649813 154193 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 248 seconds
< 1737649974 609367 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737651152 595185 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737656659 952769 PRIVMSG #esolangs :14[[07Every-machine14]]4 10 02https://esolangs.org/w/index.php?diff=150627&oldid=134908 5* 03Unname4798 5* (+207) 10
> 1737656728 548824 PRIVMSG #esolangs :14[[07Every-machine14]]4 10 02https://esolangs.org/w/index.php?diff=150628&oldid=150627 5* 03Unname4798 5* (+44) 10
> 1737657290 736577 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150629&oldid=150579 5* 03Aadenboy 5* (+57) 10/* Commands */ forgot this command
> 1737657787 889356 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150630&oldid=150629 5* 03Aadenboy 5* (+588) 10/* Examples */ implement subtraction
< 1737657838 636019 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1737657845 850547 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150631&oldid=150630 5* 03Aadenboy 5* (+49) 10/* A-B */
< 1737657887 202878 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds
> 1737657956 161597 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150632&oldid=150631 5* 03Aadenboy 5* (-12) 10/* A-B */
< 1737658012 814321 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737658231 572932 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150633&oldid=150632 5* 03Aadenboy 5* (+35) 10
> 1737658266 757535 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150634&oldid=150633 5* 03Aadenboy 5* (+0) 10/* A-B */
> 1737659548 70104 PRIVMSG #esolangs :14[[07Chops14]]4 M10 02https://esolangs.org/w/index.php?diff=150635&oldid=150100 5* 03Buckets 5* (+12) 10
> 1737659584 995128 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150636&oldid=150303 5* 03Buckets 5* (+12) 10
> 1737659633 824986 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150637&oldid=150636 5* 03Buckets 5* (+17) 10
> 1737660056 481221 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150638&oldid=150504 5* 03Buckets 5* (+9) 10
> 1737660612 277694 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150639&oldid=150260 5* 0347 5* (-139) 10/* Other things */
> 1737660958 713294 PRIVMSG #esolangs :14[[071114]]4 M10 02https://esolangs.org/w/index.php?diff=150640&oldid=148919 5* 03Buckets 5* (+310) 10
> 1737661387 274073 PRIVMSG #esolangs :14[[07User:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150641&oldid=148429 5* 0347 5* (+275) 10/* commands */
> 1737661528 144583 PRIVMSG #esolangs :14[[07Snakel/Compatibility methods14]]4 10 02https://esolangs.org/w/index.php?diff=150642&oldid=150455 5* 0347 5* (-869) 10nevermind
> 1737661617 750065 PRIVMSG #esolangs :14[[07Snakel/Syntax14]]4 10 02https://esolangs.org/w/index.php?diff=150643&oldid=149469 5* 0347 5* (-3345) 10nevermind
> 1737661709 317727 PRIVMSG #esolangs :14[[07Snakel/Errors14]]4 10 02https://esolangs.org/w/index.php?diff=150644&oldid=147804 5* 0347 5* (-2329) 10you get it already
> 1737661936 709576 PRIVMSG #esolangs :14[[07Snakel14]]4 10 02https://esolangs.org/w/index.php?diff=150645&oldid=147791 5* 0347 5* (+6276) 10so uh...
> 1737662040 437197 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=150646&oldid=149341 5* 0347 5* (-1) 10now classes do not need an implicit space
> 1737662376 438032 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=150647&oldid=150646 5* 0347 5* (-152) 10more stuff
> 1737662411 425667 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=150648&oldid=150647 5* 0347 5* (+31) 10
> 1737663132 453454 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150649&oldid=150634 5* 03Aadenboy 5* (+367) 10
> 1737663359 532477 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150650&oldid=150308 5* 0347 5* (+2) 10/* The commands */
> 1737663516 954850 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150651&oldid=150637 5* 03Buckets 5* (+19) 10
> 1737663648 807202 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150652&oldid=150651 5* 03Buckets 5* (+9) 10
> 1737663793 887955 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150653&oldid=150650 5* 0347 5* (+472) 10/* Examples */
> 1737663844 925465 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150654&oldid=150652 5* 03Buckets 5* (+0) 10
< 1737664976 873970 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 272 seconds
< 1737666946 175393 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1737666968 748918 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1737667306 716784 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737667753 968987 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737667756 158871 :Sgeo_!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737669088 219800 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737671025 901172 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737671546 372622 PRIVMSG #esolangs :14[[07Print("Hello, World!")14]]4 10 02https://esolangs.org/w/index.php?diff=150655&oldid=150228 5* 03Ractangle 5* (-2) 10/* G Sharp */
> 1737671619 378553 PRIVMSG #esolangs :14[[07Empty Program14]]4 10 02https://esolangs.org/w/index.php?diff=150656&oldid=148168 5* 03Ractangle 5* (-1) 10/* G# */
> 1737671680 405263 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=150657&oldid=150648 5* 03Ractangle 5* (-10) 10/* Infinite loop */
> 1737671821 725211 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=150658&oldid=150657 5* 03Ractangle 5* (-60) 10/* 99 bottles of beer */
> 1737671851 508760 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 10 02https://esolangs.org/w/index.php?diff=150659&oldid=150599 5* 03Ractangle 5* (-389) 10/* */
> 1737671934 740520 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 10 02https://esolangs.org/w/index.php?diff=150660&oldid=150659 5* 03Ractangle 5* (-178) 10/* G# */
< 1737672028 55186 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 265 seconds
< 1737672426 580110 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737672911 579526 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150661&oldid=150626 5* 03DGCK81LNN 5* (+1049) 10
> 1737673049 201367 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150662&oldid=150661 5* 03DGCK81LNN 5* (+18) 10/* Koishi runtime specific */
< 1737673391 910238 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737673786 117906 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150663&oldid=150662 5* 03DGCK81LNN 5* (+1014) 10/* Koishi runtime specific */
< 1737673824 195973 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Ping timeout: 264 seconds
< 1737673923 189668 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1737674707 461707 :Everything!~Everythin@195.138.86.118 QUIT :Quit: Lost terminal
> 1737675288 150425 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150664&oldid=150663 5* 03DGCK81LNN 5* (+0) 10
> 1737675533 289187 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150665&oldid=150664 5* 03DGCK81LNN 5* (+36) 10/* Practices and idioms */
> 1737675570 89287 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150666&oldid=150665 5* 03DGCK81LNN 5* (-91) 10/* Practices and idioms */
> 1737676276 705016 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150667&oldid=150666 5* 03DGCK81LNN 5* (+273) 10/* Practices and idioms */
> 1737676391 760958 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150668&oldid=150667 5* 03DGCK81LNN 5* (+19) 10/* Practices and idioms */
> 1737676443 660984 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150669&oldid=150668 5* 03DGCK81LNN 5* (+1) 10/* Practices and idioms */
> 1737676584 770219 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150670&oldid=150669 5* 03DGCK81LNN 5* (+9) 10/* Example programs */
> 1737676647 337445 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150671&oldid=150670 5* 03DGCK81LNN 5* (+15) 10/* Koishi runtime specific */
> 1737678095 517808 PRIVMSG #esolangs :14[[07User:Ashli Katt14]]4 M10 02https://esolangs.org/w/index.php?diff=150672&oldid=133092 5* 03Ashli Katt 5* (-80) 10
> 1737679314 182027 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150673&oldid=150671 5* 03Jan jelo 5* (+173) 10/* Practices and idioms */
> 1737679373 428431 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150674&oldid=150673 5* 03Jan jelo 5* (+11) 10/* Practices and idioms */
< 1737680306 135935 :xelxebar_!~xelxebar@wilsonb.com JOIN #esolangs xelxebar :ZNC - https://znc.in
< 1737680668 685914 :xelxebar!~xelxebar@wilsonb.com QUIT :Quit: ZNC 1.7.2+deb3 - https://znc.in
< 1737680669 990657 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl QUIT :Remote host closed the connection
< 1737680676 910922 :FreeFull!~freefull@83.20.58.236 JOIN #esolangs FreeFull :FreeFull
> 1737681439 383223 PRIVMSG #esolangs :14[[07Talk:Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150675&oldid=150551 5* 03PkmnQ 5* (+312) 10
< 1737683367 315984 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737684004 669709 :bgh!~bgh@2607:fb90:f202:5112:16a6:9b65:e957:db51 JOIN #esolangs * :[https://web.libera.chat] bgh
< 1737684672 453917 :moony!moony@hellomouse/dev/moony QUIT :Read error: Connection reset by peer
< 1737684701 486523 :moony7!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
> 1737684984 577087 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150676&oldid=150649 5* 03Aadenboy 5* (+306) 10edge cases
< 1737685036 446207 :Guest6479!Ae@linux.touz.org QUIT :Ping timeout: 252 seconds
< 1737685045 987912 :Ae`!Ae@linux.touz.org JOIN #esolangs * :Ae
> 1737686059 453737 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150677&oldid=150676 5* 03Aadenboy 5* (+38) 10edge case
> 1737687263 77658 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150678&oldid=150615 5* 03PrySigneToFry 5* (+871) 10
> 1737687442 868151 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150679&oldid=149554 5* 03PrySigneToFry 5* (+78) 10
> 1737687478 611726 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150680&oldid=150600 5* 03PrySigneToFry 5* (-1) 10
< 1737688420 527965 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
> 1737688436 996106 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150681&oldid=150677 5* 03Aadenboy 5* (-226) 10/* A-B */ better subtraction algorithm
> 1737688710 95074 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150682&oldid=150681 5* 03Aadenboy 5* (+103) 10implemented
> 1737689021 581343 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150683&oldid=150674 5* 03Jan jelo 5* (+359) 10/* Example programs */
> 1737689045 618318 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150684&oldid=150683 5* 03Jan jelo 5* (-4) 10/* Example programs */
> 1737689072 289149 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150685&oldid=150684 5* 03Jan jelo 5* (-11) 10/* Example programs */
> 1737689351 660677 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=150686&oldid=150685 5* 03Jan jelo 5* (-5) 10/* Example programs */ oh,I can use arr@
< 1737690031 657615 :Sgeo_!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737690155 458526 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737690815 891597 :bgh!~bgh@2607:fb90:f202:5112:16a6:9b65:e957:db51 QUIT :Quit: Client closed
< 1737691275 290604 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1737693638 483197 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150687&oldid=150534 5* 03MihaiEso 5* (+500) 10/* X-script 3.1? */
< 1737693813 656563 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1737693964 377204 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 260 seconds
> 1737696211 339624 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150688&oldid=150682 5* 03Aadenboy 5* (+6) 10/* A-B */
> 1737696957 433184 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=150689&oldid=150533 5* 03Ellos 5* (+151) 10/* Introductions */
> 1737699530 861990 PRIVMSG #esolangs :14[[07X-script/Examples14]]4 10 02https://esolangs.org/w/index.php?diff=150690&oldid=150592 5* 03PrySigneToFry 5* (+67) 10
> 1737699809 104954 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150691&oldid=150687 5* 03PrySigneToFry 5* (+987) 10
> 1737700252 126260 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150692&oldid=150613 5* 03Jan jelo 5* (+295) 10/* QWOP */
> 1737700325 801573 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150693&oldid=150692 5* 03Jan jelo 5* (-296) 10/* Smalltalk */ wait,I read it wrong
> 1737700374 112418 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150694&oldid=150693 5* 03Jan jelo 5* (+295) 10/* Smalltalk */
> 1737700466 806208 PRIVMSG #esolangs :14[[07Anti-Plushie language/PSTF14]]4 10 02https://esolangs.org/w/index.php?diff=150695&oldid=150036 5* 03PrySigneToFry 5* (-237) 10
> 1737700610 149694 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=150696&oldid=150236 5* 03PrySigneToFry 5* (+70) 10
< 1737702689 453923 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1737703840 42910 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150697&oldid=150678 5* 03Ractangle 5* (-5) 10we fix spelling
> 1737703941 961434 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150698&oldid=150679 5* 03Ractangle 5* (+225) 10/* To get code-golfing, I recommend to use the Base-100. */
> 1737704017 67014 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150699&oldid=150680 5* 03Ractangle 5* (+5) 10
< 1737705279 276671 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737706207 687951 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737706406 25955 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150700&oldid=150694 5* 03Jan jelo 5* (+108) 10/* DUP */
> 1737706747 294341 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150701&oldid=150697 5* 03I am islptng 5* (+13) 10/* LifeWiki is down! */
> 1737706813 140128 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150702&oldid=150700 5* 03Jan jelo 5* (+168) 10/* Lisp */
< 1737711604 577804 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737715464 302566 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737715563 131503 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150703&oldid=150702 5* 03Jan jelo 5* (-4745) 10/* Brainfuck */ replace into a shorter one
> 1737718776 987919 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150704&oldid=150595 5* 03PrySigneToFry 5* (+49) 10
< 1737718882 436757 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737720266 901843 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 272 seconds
< 1737720291 814066 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737720372 220950 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737723394 566052 PRIVMSG #esolangs :14[[07Talk:List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150705&oldid=117628 5* 03Blashyrkh 5* (+268) 10Some doubts about Subleq quine
< 1737723588 650658 :visilii!~visilii@46.61.242.99 QUIT :Read error: Connection reset by peer
< 1737723667 142050 :visilii!~visilii@46.61.242.99 JOIN #esolangs * :ZNC - https://znc.in
> 1737723968 645950 PRIVMSG #esolangs :14[[07Talk:List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150706&oldid=150705 5* 03Blashyrkh 5* (+91) 10/* Subleq */
> 1737724786 181317 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150707&oldid=150703 5* 03Blashyrkh 5* (+2846) 10/* Real Quines */ Lazy K quine, implemented a couple of years ago
< 1737725910 895389 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1737726025 27528 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1737726115 593363 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150708&oldid=150707 5* 03Jan jelo 5* (-1707) 10/* Brainfuck */ replace it into a shorter one
> 1737726539 566622 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150709&oldid=150176 5* 03Blashyrkh 5* (+184) 10
> 1737727102 781880 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150710&oldid=150709 5* 03Jan jelo 5* (+26) 10/* Brainfuck quine */
> 1737727584 579927 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150711&oldid=150710 5* 03Blashyrkh 5* (+112) 10/* Brainfuck quine */
> 1737727617 929632 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=150712&oldid=150711 5* 03Jan jelo 5* (+7) 10/* Brainfuck quine */
> 1737727987 827837 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=150713&oldid=150708 5* 03Jan jelo 5* (+33) 10/* Brainfuck */
> 1737728022 358020 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=150714&oldid=150713 5* 03Jan jelo 5* (-1) 10/* Brainfuck */
> 1737728193 661588 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=150715&oldid=150714 5* 03Jan jelo 5* (-4) 10/* Brainfuck */
< 1737728546 278991 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1737731510 147238 PRIVMSG #esolangs :14[[07User:B jonas14]]4 10 02https://esolangs.org/w/index.php?diff=150716&oldid=147561 5* 03B jonas 5* (+6) 10/* Games that the esolangs community plays */
< 1737732902 455739 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737733597 202180 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=150717&oldid=150715 5* 03Jan jelo 5* (+95) 10/* Bash */
< 1737735580 351160 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737735679 873524 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737735709 535264 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
> 1737737538 726045 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150718&oldid=150688 5* 03Aadenboy 5* (+1215) 10/* Basic arithmetic */ implement modulus
> 1737738089 258068 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150719&oldid=150718 5* 03Aadenboy 5* (+656) 10/* Basic arithmetic */ implement floored division
> 1737738114 789570 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150720&oldid=150719 5* 03Aadenboy 5* (+11) 10/* A/B */
< 1737739353 210944 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 252 seconds
< 1737740535 499297 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, okay, I see how to parse BIIA? in one pass. With lots of reallocation or slicing/indexing arithmetic. Not worth it.
< 1737741159 399548 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737741653 391832 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=150721&oldid=149937 5* 0347 5* (+153) 10/* Syntax */
> 1737741671 569625 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=150722&oldid=150721 5* 0347 5* (-2) 10/* Truth-machine */
> 1737741729 171638 PRIVMSG #esolangs :14[[07List of ideas14]]4 10 02https://esolangs.org/w/index.php?diff=150723&oldid=148876 5* 03B jonas 5* (+465) 10/* Ideas for Names */ ambiguous classical mythology names
< 1737741852 582827 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :korvo: you can use one of the union tree structures in CLRS to find the connected components in one pass, but it's indeed not worth because parsing is just a small part of running a BIIA program so the rest of the execution will overshadow it in resource costs anyway.
< 1737741904 33119 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :b_jonas: Sure. What I'm finding is that the allocation of each tile's storage needs to be bounded, and so I need a pass to compute the bounds before I can start copying into the tile. The graph traversal is indeed a very slick way to get that first pass done.
< 1737741978 252945 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :you could also borrow a Piet parser for this
< 1737741986 261134 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :since that identifies connected components as well
< 1737742269 746031 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737742313 548152 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I'm set. Next step is to figure out non-interactive execution, starting with cases without I/O.
> 1737743164 83861 PRIVMSG #esolangs :14[[07Anti-Plushie language14]]4 M10 02https://esolangs.org/w/index.php?diff=150724&oldid=142465 5* 03Aadenboy 5* (+97) 10
> 1737743179 447746 PRIVMSG #esolangs :14[[07Anti-Plushie language14]]4 M10 02https://esolangs.org/w/index.php?diff=150725&oldid=150724 5* 03Aadenboy 5* (+3) 10
< 1737743890 266068 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737744325 652235 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 244 seconds
< 1737744606 519617 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737746953 313673 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737747107 26091 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737747716 509198 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737747840 28557 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737747915 332272 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, non-interactive execution is just graph search. So interactive BIIA? should be mere interleaving of search with I/O, with output only -- uh, I guess I need terms.
< 1737747985 922681 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :A *corner* will be a partial witness rectangle, filled in at (0,0), with no empty spaces in its interior. A *corner tile* has (0,0) filled in.
< 1737748043 399040 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :So, search can be decomposed into discrete sets of corners, starting with the set of corner tiles. Then I/O should be possible whenever the current set of corners all agree on the output.
< 1737748049 306570 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :"just graph search"?
< 1737748056 791250 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :what do you mean?
< 1737748077 943744 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :To make that interactive, merely constrain the search relative to current input, and make the output relative to some initial segment of already-emitted output.
< 1737748122 454832 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Like, we can imagine a graph whose vertices are corners and whose edges are labeled by tiles; an edge labeled with tile T indicates that T can be fitted to the source corner to form the target corner.
< 1737748151 522846 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :And then execution is merely graph search, looking for at least one corner which is a witness. The given semantics don't really allow for anything simpler.
< 1737748196 5106 :int-e!~noone@int-e.eu PRIVMSG #esolangs :"not worth it" - funnily enough I implement disjoint set forests relatively often because I think they're simple. (I'll do it in Haskell and pay the log(n) overhead from using persistent data structures instead of arrays)
< 1737748258 668469 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :int-e: sure, but I'm saying specifically for But is it art
< 1737748323 956375 :int-e!~noone@int-e.eu PRIVMSG #esolangs :b_jonas: Yeah I have no point. Except maybe that there's more than one cost metric.
< 1737748359 788975 :int-e!~noone@int-e.eu PRIVMSG #esolangs :It's more of a tangent while I'm reminding myself what the semantics of BIIA are.
< 1737748690 87895 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Ugh, I'm going to have to write an event loop if I want to do this from RPython. Debating whether to reuse the libuv bindings I wrote a while ago or hack up something that only handles stdio.
< 1737748737 723997 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :...Or I could just put stdin into non-blocking mode. What's the worst that could happen~
< 1737749070 356176 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(Ugh those semantics are awful :P I mean, from the perspective of actually trying to implement them.)
< 1737749236 168864 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1737749649 743020 :int-e!~noone@int-e.eu PRIVMSG #esolangs :b_jonas: And the reason why I don't think that it's overkill is because when scanning input linearly, you can have some pretty complicated intermediate connectivity relations that eventually collapse into a single component. https://paste.debian.net/1346663/ But indeed... this is just for parsing and that's not the difficult part.
< 1737749872 931682 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :...Wait, are tiles allowed to be non-convex? I wasn't sure.
< 1737749899 751195 :int-e!~noone@int-e.eu PRIVMSG #esolangs :yes
< 1737749922 832359 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I /assume/ that they can also have holes
< 1737749932 410994 :int-e!~noone@int-e.eu PRIVMSG #esolangs :all the spec says is that they're connected
< 1737749944 321893 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(and since holes are finite you can assume that there aren't any w.l.o.g.
< 1737749946 171671 :int-e!~noone@int-e.eu PRIVMSG #esolangs :)
< 1737749998 196619 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(you can pre-fill them; that may result in exponentially more tiles)
< 1737750042 127188 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Couldn't that require pre-computing all possible inputs? "Exponentially" sounds like a real issue.
< 1737750082 162 :int-e!~noone@int-e.eu PRIVMSG #esolangs :No, this is pure preprocessing.
< 1737750087 416444 :int-e!~noone@int-e.eu PRIVMSG #esolangs :No input is involved yet.
< 1737750092 755727 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(Or output)
> 1737750149 785761 PRIVMSG #esolangs :14[[07Egel14]]4 10 02https://esolangs.org/w/index.php?diff=150726&oldid=94234 5* 03B jonas 5* (+1034) 10Example programs
< 1737750173 144777 :int-e!~noone@int-e.eu PRIVMSG #esolangs :You parse all tiles. Then, for each tile with a hole, you fill the hole in all possible ways and use the resulting unholey tiles instead.
< 1737750228 486393 :int-e!~noone@int-e.eu PRIVMSG #esolangs :For implementations that try to be practical as much as possible this is probably a terrible idea of course.
< 1737750313 584026 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Yeah. Still, I see what you're saying about the theory. I suppose I could assume for now that there aren't any holes, and then add that preprocessing later on.
< 1737750350 259254 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But it would multiply everything by a number of tiles, when instead the holes could be like mini-constraints with their own mini-clauses to satisfy.
< 1737750364 867027 :int-e!~noone@int-e.eu PRIVMSG #esolangs :yep
< 1737750387 469777 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It's analogous to pre-computing tables for grammars, knowing that often it's possible to pre-compute one more layer by multiplying everything by some uncomfortably large constant.
< 1737750418 295590 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :(Where "uncomfortably large" is around 1.01 or so? And in practice computer science requires it to be at least 2, which is terrifying.)
< 1737751038 855502 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh nice. It's not all that hard to prove that that compositeness test works.
< 1737751451 159422 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(Idea: Relabel the tiles as follows, https://paste.debian.net/1346669/ and then reason from the bottom that any rectangle you fill will be a 3n x 2m rectangle. Then look at the top right to see that n,m > 1.)
< 1737751594 907135 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(Each eb/+++ belongs to a separate tile; the ambiguity is limited to whether the - characters connect to the top or to the right and bottom.)
< 1737751647 610451 :int-e!~noone@int-e.eu PRIVMSG #esolangs :err, or to the left
> 1737753672 889581 PRIVMSG #esolangs :14[[07List of ideas14]]4 10 02https://esolangs.org/w/index.php?diff=150727&oldid=150723 5* 03Ractangle 5* (+133) 10/* Ideas for Names */
< 1737754042 640983 :bgh!~bgh@2607:fb90:f202:5112:16a6:9b65:e957:db51 JOIN #esolangs * :[https://web.libera.chat] bgh
< 1737754232 424741 :bgh!~bgh@2607:fb90:f202:5112:16a6:9b65:e957:db51 PART :#esolangs
> 1737754765 858995 PRIVMSG #esolangs :14[[07Counterlang14]]4 10 02https://esolangs.org/w/index.php?diff=150728&oldid=150572 5* 03Kaveh Yousefi 5* (+37) 10Rectified the Extended Backus-Naur Form (EBNF) description in order to admit counter names as subtrahends.
< 1737755411 784019 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh and I guess this also shows that we can drop the middle column from all tiles and it still works (one needs to shift the 'eb' part too).
> 1737755893 532513 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150729&oldid=150550 5* 03Calculus is fun 5* (-2) 10/* 99 bottles of beer */
> 1737757603 369971 PRIVMSG #esolangs :14[[07D.U.C.K.14]]4 M10 02https://esolangs.org/w/index.php?diff=150730&oldid=108082 5* 03Calculus is fun 5* (+0) 10black whole -> black hole
< 1737758075 728313 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1737758217 244157 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150731&oldid=150610 5* 03Aadenboy 5* (+40) 10/* Iterate */ update
< 1737758698 228000 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737759294 538373 :APic!apic@apic.name PRIVMSG #esolangs :cuy
< 1737759295 526256 :APic!apic@apic.name PRIVMSG #esolangs :-y
< 1737761029 930299 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737761570 761850 PRIVMSG #esolangs :14[[07TimeWaste14]]4 M10 02https://esolangs.org/w/index.php?diff=150732&oldid=106654 5* 03TheCanon2 5* (+29) 10Turing completeness ignores delays
> 1737763434 59336 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150733&oldid=150729 5* 03Calculus is fun 5* (+223) 10Added small tip for run
< 1737763436 52621 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1737763557 33226 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737767424 232330 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1737769645 312454 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737776963 547355 :ManDeJan!3da94070ba@user/mandejan QUIT :Server closed connection
< 1737776970 939846 :ManDeJan!3da94070ba@user/mandejan JOIN #esolangs ManDeJan :ManDeJan
< 1737777569 405322 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs * :Claire Rodriguez
< 1737777717 105007 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 248 seconds
< 1737777812 270797 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1737777826 611706 PRIVMSG #esolangs :14[[07Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150734&oldid=150720 5* 03Aadenboy 5* (+1128) 10/* Basic arithmetic */ implement conditional
> 1737777977 996410 PRIVMSG #esolangs :14[[07Talk:Iterate14]]4 10 02https://esolangs.org/w/index.php?diff=150735&oldid=150675 5* 03Aadenboy 5* (+547) 10
> 1737778383 122611 PRIVMSG #esolangs :14[[07Iterate14]]4 M10 02https://esolangs.org/w/index.php?diff=150736&oldid=150734 5* 03Aadenboy 5* (+113) 10/* Conditionals */ move the ==0 check to the top for edge cases
< 1737782470 765560 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh. TIL that the algorithm I figured out in university for fitting Tetris pieces is not sufficiently general to fit BIIA? tiles. Obvious in retrospect.
< 1737782508 450438 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Currently trying to figure out how to know when a tile could be a reasonable candidate for fitting at a specific location, and all of the nice induction I built up for corners doesn't hold for arbitrary tiles.
< 1737782584 473227 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Nor do tiles have to admit any sort of nice extent or boundary. So I have to think about the case where a very wide/long tile is mixed with a lot of tiny tiles and avoid building overly-long candidates that can't be filled in.
> 1737782790 978077 PRIVMSG #esolangs :14[[07Lento14]]4 10 02https://esolangs.org/w/index.php?diff=150737&oldid=89528 5* 03Somefan 5* (+47) 10
< 1737783953 570315 :ursa-major!114efe6c39@2a03:6000:1812:100::11f3 QUIT :Server closed connection
< 1737783962 645678 :ursa-major!114efe6c39@2a03:6000:1812:100::11f3 JOIN #esolangs ursa-major :Bailey Bjornstad
> 1737784166 56169 PRIVMSG #esolangs :14[[07Anti-Plushie language14]]4 10 02https://esolangs.org/w/index.php?diff=150738&oldid=150725 5* 03PrySigneToFry 5* (+136) 10
< 1737784363 792354 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1737784432 222033 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in
< 1737784455 954780 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :BIIA? is surprisingly difficult to implement for being such a "simple" language
< 1737784506 222914 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :fwiw, my thoughts on parsing it involved a union-find data structure; you could actually parse it very simply via simply scanning line by line and adding each nonempty character to the same union as the adjacent ones
< 1737784535 767111 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but that doesn't help much with the fitting step, which is the hard one and one I don't know how to implement efficiently
> 1737784698 557109 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150739&oldid=150704 5* 03PrySigneToFry 5* (+574) 10
< 1737785281 15734 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Conceptually, the major difficulty is that the witness search must be complete. If I were allowed to half-ass it, then it'd be easy to write an unfair search that almost never succeeds.
< 1737785372 717085 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I like the union-find insight. It's much cleaner than what I did; I copied the input to a `bytearray`, a secret Python class that is like `str` but allows mutation, and then I blank out each tile after I find it. So I don't have to worry about whether I've already seen some part of some other tile.
< 1737785669 652673 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1737785750 111932 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in
< 1737786403 715080 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: I think your algorithm is linear-time, isn't it? as long as you scan in order and blank each tile the moment you find the first character within it
< 1737786424 321142 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :because each cell is examined at most six times (once when scanning, once when blanking, and four times when blanking its neighbours)
< 1737786465 668446 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: Yes, the outer loops are definitely bounded and run once over the indices of the array.
< 1737786478 476134 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :so despite being a bit less elegant it might actually be faster, depending on the relative overheads of the two approaches
< 1737786480 786206 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ACTION tends to trade space for time
> 1737788078 908128 PRIVMSG #esolangs :14[[07x RGB8 panel14]]4 N10 02https://esolangs.org/w/index.php?oldid=150740 5* 03Unname4798 5* (+659) 10Created page with "^ RGB8 panel is an esolang created by Unname4798 in response to [[16x16 RGB2 panel]] == Commands == + increment - decrement > right < left / increment dimension the pointer is moving in \ decrement dimension the pointer is moving in [ when the selected cell
> 1737788133 818038 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150741&oldid=150619 5* 03Unname4798 5* (+42) 10
> 1737788189 841079 PRIVMSG #esolangs :14[[07x RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150742&oldid=150740 5* 03Unname4798 5* (+36) 10
> 1737788287 83436 PRIVMSG #esolangs :14[[07x RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150743&oldid=150742 5* 03Unname4798 5* (+49) 10
> 1737788327 178047 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Unname4798 5* 10moved [[02x RGB8 panel10]] to [[^ RGB8 panel]]
> 1737788344 72503 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150746&oldid=150741 5* 03Unname4798 5* (+0) 10
> 1737788363 184631 PRIVMSG #esolangs :14[[07x RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150747&oldid=150745 5* 03Unname4798 5* (-32) 10Blanked the page
> 1737788538 674996 PRIVMSG #esolangs :14[[07^ RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150748&oldid=150744 5* 03Unname4798 5* (+146) 10
> 1737788589 78126 PRIVMSG #esolangs :14[[07^ RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150749&oldid=150748 5* 03Unname4798 5* (-88) 10
> 1737789775 157555 PRIVMSG #esolangs :14[[07^ RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150750&oldid=150749 5* 03Unname4798 5* (+33) 10
> 1737789866 287979 PRIVMSG #esolangs :14[[07^ RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150751&oldid=150750 5* 03Unname4798 5* (+39) 10
> 1737790072 344815 PRIVMSG #esolangs :14[[07Binary License Plate Language14]]4 10 02https://esolangs.org/w/index.php?diff=150752&oldid=148804 5* 03Unname4798 5* (-93) 10
< 1737790104 493710 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Read error: Connection reset by peer
< 1737790214 908776 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
< 1737790214 946800 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Remote host closed the connection
< 1737791910 385237 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737792930 159673 PRIVMSG #esolangs :14[[07User talk:Yayimhere14]]4 10 02https://esolangs.org/w/index.php?diff=150753&oldid=147105 5* 03PrySigneToFry 5* (+1108) 10/* Will you contribute to my X-script? */ new section
< 1737794993 549835 :FreeFull!~freefull@83.20.58.236 QUIT :Server closed connection
< 1737795003 464625 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737799313 547763 :Ae`!Ae@linux.touz.org QUIT :Server closed connection
< 1737799323 227715 :Ae`!Ae@linux.touz.org JOIN #esolangs * :Ae
> 1737802741 854169 PRIVMSG #esolangs :14[[07Amo gus14]]4 10 02https://esolangs.org/w/index.php?diff=150754&oldid=148112 5* 03PrySigneToFry 5* (+208) 10
> 1737803973 798560 PRIVMSG #esolangs :14[[07Amo gus14]]4 10 02https://esolangs.org/w/index.php?diff=150755&oldid=150754 5* 03PrySigneToFry 5* (+0) 10
< 1737804204 790068 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737804339 891635 PRIVMSG #esolangs :14[[07Amo gus14]]4 10 02https://esolangs.org/w/index.php?diff=150756&oldid=150755 5* 03PrySigneToFry 5* (+3) 10
> 1737805542 666618 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 N10 02https://esolangs.org/w/index.php?oldid=150757 5* 03Blashyrkh 5* (+2666) 10Kolakoski sequence in Brainfuck with logarithmic memory consumption, with comments
> 1737805912 805643 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150758&oldid=150452 5* 03Blashyrkh 5* (+504) 10/* brainfuck */ Another brainfuck example, now with o(log n) memory consumption
> 1737806121 465654 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150759&oldid=150757 5* 03Blashyrkh 5* (+2) 10
> 1737806350 148986 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150760&oldid=150759 5* 03Blashyrkh 5* (+149) 10/* Kolakoski sequence generation implemented in Brainfuck with logarithmic memory consumption */
< 1737806467 336683 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737806546 88379 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1737806816 796049 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737806927 165771 PRIVMSG #esolangs :14[[07Amo gus14]]4 10 02https://esolangs.org/w/index.php?diff=150761&oldid=150756 5* 03PrySigneToFry 5* (+0) 10
< 1737807193 370948 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737807531 768275 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150762&oldid=148488 5* 0347 5* (+1) 10/* Syntax */
> 1737807585 252500 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150763&oldid=150762 5* 0347 5* (+0) 10/* Examples */
> 1737807598 561493 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150764&oldid=150763 5* 0347 5* (-18) 10/* Syntax */
> 1737807783 930180 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150765&oldid=150764 5* 0347 5* (+45) 10/* Interpreter */
> 1737807865 491807 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150766&oldid=150765 5* 0347 5* (-1) 10/* Hello, world! */
> 1737807881 38233 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150767&oldid=150766 5* 0347 5* (+0) 10/* Interpreter */
> 1737807952 917253 PRIVMSG #esolangs :14[[07Amo gus14]]4 10 02https://esolangs.org/w/index.php?diff=150768&oldid=150761 5* 03PrySigneToFry 5* (-7) 10
> 1737808109 351174 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=150769&oldid=150767 5* 0347 5* (-6) 10/* Hello, world! */
> 1737808221 115964 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (H-M)14]]4 10 02https://esolangs.org/w/index.php?diff=150770&oldid=149827 5* 0347 5* (-7) 10/* How dare you fuck the brain */
> 1737808398 506325 PRIVMSG #esolangs :14[[07Talk:SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150771&oldid=150616 5* 03PrySigneToFry 5* (+910) 10
> 1737808468 638075 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150772&oldid=150760 5* 03Blashyrkh 5* (+216) 10Few thoughts about further enhancements
< 1737809310 544259 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737811511 439896 PRIVMSG #esolangs :14[[07Zyxonia14]]4 N10 02https://esolangs.org/w/index.php?oldid=150773 5* 03PrySigneToFry 5* (+5721) 10Created page with "Zyxonia(pronounced /ziksni/) is an Esolang designed by PSTF. = Language Overview = Zyxonia is a quasi-assembly, high-level, and powerful programming language. It uses an easy-to-understand but cumbersome syntax, and is capable of writing extremely powerful progra
> 1737811552 490072 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150774&oldid=150638 5* 03PrySigneToFry 5* (+14) 10
> 1737812528 524561 PRIVMSG #esolangs :14[[07User:YufangTSTSU/sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150775&oldid=148658 5* 03YufangTSTSU 5* (-1982) 10Blanked the page
> 1737812992 111520 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150776&oldid=150436 5* 0347 5* (-993) 10welp. i am rebranding array into unai
< 1737813820 952668 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737815600 557335 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1737817188 692219 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1737817343 180683 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03AdjectiveNounNumber 5* 10uploaded "[[02File:When start.png10]]"
< 1737817679 952348 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net CHGHOST ~DOS_User_ :user/DOS-User-webchat:37962
> 1737818058 725293 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03AdjectiveNounNumber 5* 10uploaded "[[02File:Define object, variable varname.png10]]"
> 1737818146 224286 PRIVMSG #esolangs :14[[07Spellblocks14]]4 N10 02https://esolangs.org/w/index.php?oldid=150779 5* 03AdjectiveNounNumber 5* (+793) 10Created page with "Spellblocks is an [[esoteric programming language]] simiar to [https://scratch.mit.edu/ Scratch] created by [[User:AdjectiveNounNumber]] (me!) on January 25, 2025 ET. very WIP {| class="wikitable" |+ Blocks |- ! Block Name !! Description !! Scratch Repre
< 1737818988 955533 :molson_!~molson@2605-4A80-2101-99D0-D106-1E39-2E45-4C88-dynamic.midco.net JOIN #esolangs molson :realname
> 1737818996 407103 PRIVMSG #esolangs :14[[07Small14]]4 M10 02https://esolangs.org/w/index.php?diff=150780&oldid=133140 5* 03TheCanon2 5* (+401) 10
< 1737819153 985460 :molson!~molson@2605-4A80-2101-99D0-2336-79DF-71EA-5489-dynamic.midco.net QUIT :Ping timeout: 248 seconds
< 1737819194 989648 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737819706 251429 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737819974 290404 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737820502 350353 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1737820835 117543 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737821181 974270 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737825071 949084 :Thelie!~Thelie@cgn-89-1-218-5.nc.de JOIN #esolangs Thelie :Thelie
> 1737825248 87722 PRIVMSG #esolangs :14[[07Fixed Repeating Output14]]4 10 02https://esolangs.org/w/index.php?diff=150781&oldid=139859 5* 0347 5* (-14) 10/* How dare you fuck the brain */
> 1737826755 397709 PRIVMSG #esolangs :14[[07Fixed Repeating Output14]]4 10 02https://esolangs.org/w/index.php?diff=150782&oldid=150781 5* 03Aadenboy 5* (+96) 10/* Implementations */ add [[Iterate]]
< 1737826833 965671 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1737827926 614819 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737829095 672526 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737829554 679946 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737829580 156547 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net CHGHOST ~DOS_User_ :user/DOS-User-webchat:37962
< 1737829651 977726 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1737829677 711234 :DOS_User!~DOS_User@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User
< 1737829692 384274 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737829721 149196 :DOS_User!~DOS_User@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737829780 678515 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1737829866 307128 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 NICK :DOS_User
< 1737829892 46178 :DOS_User!~DOS_User_@user/DOS-User-webchat:37962 NICK :DOS_User_webchat
< 1737829912 879804 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1737830764 486547 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds
< 1737830765 415734 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737830802 933075 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737830906 477813 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737830941 954516 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737831549 147895 PRIVMSG #esolangs :14[[07BIIA14]]4 N10 02https://esolangs.org/w/index.php?oldid=150783 5* 03B jonas 5* (+28) 10Redirected page to [[But Is It Art?]]
< 1737832573 328228 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1737834427 31313 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737834885 250113 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737835727 672279 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737836537 514703 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Remote host closed the connection
< 1737836894 223928 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737837589 592683 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737837857 381999 :Thelie!~Thelie@cgn-89-1-218-5.nc.de QUIT :Quit: Leaving.
> 1737837907 885627 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=150784&oldid=150772 5* 03Blashyrkh 5* (-351) 10Shorter version
> 1737837976 601095 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150785&oldid=150758 5* 03Blashyrkh 5* (-24) 10/* brainfuck */ Shorter version
> 1737838189 685543 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150786&oldid=150785 5* 03Blashyrkh 5* (+28) 10/* brainfuck */
> 1737838778 478826 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150787&oldid=150784 5* 03Blashyrkh 5* (+203) 10
> 1737838876 465575 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150788&oldid=150787 5* 03Blashyrkh 5* (-203) 10Undo revision [[Special:Diff/150787|150787]] by [[Special:Contributions/Blashyrkh|Blashyrkh]] ([[User talk:Blashyrkh|talk]])
< 1737839582 652907 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737840624 443468 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737840771 82592 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737842838 104174 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 265 seconds
> 1737843124 99271 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=150789&oldid=149395 5* 03Ractangle 5* (+138) 10
< 1737843517 219616 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Remote host closed the connection
< 1737843560 766204 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737843694 14410 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Read error: Connection reset by peer
> 1737843864 995644 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150790&oldid=150733 5* 03Calculus is fun 5* (+536) 10Infinity is a thing now, cool!
< 1737844031 320348 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737844054 903416 :ajal!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1737844256 659107 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150791&oldid=150790 5* 03Calculus is fun 5* (+122) 10Added hyperStep
< 1737844287 258727 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Ping timeout: 244 seconds
> 1737844329 540380 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150792&oldid=150791 5* 03Calculus is fun 5* (+1) 10/* Infinity */
> 1737844359 367983 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150793&oldid=150792 5* 03Calculus is fun 5* (-1) 10/* Standard operations */
< 1737844536 419793 :ajal!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Read error: Connection reset by peer
< 1737845632 716867 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737847632 138304 PRIVMSG #esolangs :14[[07Esolang talk:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150794&oldid=147588 5* 03Aadenboy 5* (+137) 10/* Category for esoteric supersets */ new section
> 1737847653 159027 PRIVMSG #esolangs :14[[07Esolang talk:Categorization14]]4 M10 02https://esolangs.org/w/index.php?diff=150795&oldid=150794 5* 03Aadenboy 5* (+287) 10/* Category for esoteric supersets */ whoops forgot to sign it
> 1737847850 838682 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 M10 02https://esolangs.org/w/index.php?diff=150796&oldid=150388 5* 03Aadenboy 5* (+110) 10/* Miscellaneous */ list [[Category:Esoteric subset]]
< 1737848260 719651 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737848301 997882 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net CHGHOST ~DOS_User_ :user/DOS-User-webchat:37962
< 1737848901 289697 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1737849860 519758 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737849965 211981 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1737853061 162862 PRIVMSG #esolangs :14[[07WrongFuck14]]4 10 02https://esolangs.org/w/index.php?diff=150797&oldid=128958 5* 03Kaveh Yousefi 5* (+3964) 10Rectified the cat program, which bore its + and - symbols confounded, introduced a truth-machine example, and added conversion operations in the Common Lisp programming language betwixt WrongFuck and brainfuck.
> 1737853223 99484 PRIVMSG #esolangs :14[[07WrongFuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150798&oldid=150797 5* 03Kaveh Yousefi 5* (+0) 10Rectified the formatting of the conversion functions.
< 1737854739 997333 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737854756 925138 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
> 1737856175 712638 PRIVMSG #esolangs :14[[07User talk:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=150799&oldid=150585 5* 03PrySigneToFry 5* (+52) 10
> 1737856584 675732 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=150800&oldid=150597 5* 03Ais523 5* (+198) 10/* Soft redirect */ can even use a hard redirect if it's in userspace
> 1737858928 165759 PRIVMSG #esolangs :14[[07User:GUAqwq/brainfuck quine14]]4 10 02https://esolangs.org/w/index.php?diff=150801&oldid=140582 5* 03GUAqwq 5* (-739) 10
< 1737858947 961175 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737859758 64577 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=150802&oldid=150460 5* 03AdjectiveNounNumber 5* (+70) 10
> 1737859892 874048 PRIVMSG #esolangs :14[[07013414]]4 10 02https://esolangs.org/w/index.php?diff=150803&oldid=150596 5* 03PrySigneToFry 5* (+97) 10
< 1737860702 843834 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1737860733 702848 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
> 1737861854 258475 PRIVMSG #esolangs :14[[07Stub14]]4 10 02https://esolangs.org/w/index.php?diff=150804&oldid=150565 5* 03PrySigneToFry 5* (+190) 10
> 1737861972 594727 PRIVMSG #esolangs :14[[07Stub14]]4 M10 02https://esolangs.org/w/index.php?diff=150805&oldid=150804 5* 03Aadenboy 5* (+1) 10/* Hello, World! */
> 1737862743 113207 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=150806&oldid=150717 5* 03Jan jelo 5* (+575) 10/* Brainfuck */ some explanations
< 1737867665 17918 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737868815 207965 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737868952 598054 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737869158 538345 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
> 1737869814 826583 PRIVMSG #esolangs :14[[07Stub14]]4 10 02https://esolangs.org/w/index.php?diff=150807&oldid=150805 5* 03PrySigneToFry 5* (+0) 10
> 1737870070 650697 PRIVMSG #esolangs :14[[0799 bottles of beer14]]4 10 02https://esolangs.org/w/index.php?diff=150808&oldid=150660 5* 03WinslowJosiah 5* (+7022) 10Add 99BoB in Bespoke (it'd be lovely to turn this into "poetic" form, though)
> 1737870092 458074 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150809&oldid=150699 5* 03PrySigneToFry 5* (+142) 10
> 1737870314 638162 PRIVMSG #esolangs :14[[07A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150810&oldid=150731 5* 03None1 5* (-147) 10
> 1737870348 23104 PRIVMSG #esolangs :14[[07Talk:A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150811&oldid=150540 5* 03None1 5* (+308) 10
< 1737874867 84169 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737874994 86919 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
< 1737875521 42175 :chomwitt!~alex@2a02:587:7a1b:2100:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 265 seconds
< 1737877573 962172 :chomwitt!~alex@ppp-94-67-189-44.home.otenet.gr JOIN #esolangs chomwitt :realname
> 1737878945 441090 PRIVMSG #esolangs :14[[07Zyxonia/Compile14]]4 N10 02https://esolangs.org/w/index.php?oldid=150812 5* 03PrySigneToFry 5* (+2324) 10Created page with "{{Back|Zyxonia}} Zyxonia uses a compiling system like C/C++. = How did it work? = It can roughly divided to 5 parts. == Part I: Clean == In the "clean" phase, Zyxonia deletes the comments and unused waste variables in the code, then expands all iteratio
> 1737879090 752880 PRIVMSG #esolangs :14[[07Zyxonia14]]4 10 02https://esolangs.org/w/index.php?diff=150813&oldid=150773 5* 03PrySigneToFry 5* (+47) 10
> 1737882158 174210 PRIVMSG #esolangs :14[[07Talk:A+B Problem14]]4 10 02https://esolangs.org/w/index.php?diff=150814&oldid=150811 5* 03Blashyrkh 5* (+383) 10
> 1737883058 48566 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Coobird 5* 10New user account
< 1737883269 543834 :Sgeo_!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737883283 428740 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737883751 136267 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150815&oldid=150788 5* 03Blashyrkh 5* (+122) 10/* Kolakoski sequence generation implemented in Brainfuck with logarithmic memory consumption */
> 1737884766 311382 PRIVMSG #esolangs :14[[07Stub14]]4 10 02https://esolangs.org/w/index.php?diff=150816&oldid=150807 5* 03Ractangle 5* (+0) 10you missed the joke
< 1737885051 221246 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737885147 186618 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Client Quit
< 1737885244 447525 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1737885443 269329 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150817&oldid=150689 5* 03Coobird 5* (+230) 10/* Introductions */
> 1737886114 457867 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=150818&oldid=149335 5* 03Coobird 5* (+325) 10
> 1737887690 182058 PRIVMSG #esolangs :14[[07TM14]]4 10 02https://esolangs.org/w/index.php?diff=150819&oldid=113675 5* 03I am islptng 5* (+234) 10Removed redirect to [[]]
> 1737887788 212852 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150820&oldid=150809 5* 03I am islptng 5* (+17) 10
> 1737888876 877015 PRIVMSG #esolangs :14[[07TM14]]4 10 02https://esolangs.org/w/index.php?diff=150821&oldid=150819 5* 03I am islptng 5* (+130) 10
> 1737889121 94612 PRIVMSG #esolangs :14[[07Poetic (family)14]]4 10 02https://esolangs.org/w/index.php?diff=150822&oldid=148455 5* 03Unname4798 5* (+13) 10
> 1737889240 302360 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150823&oldid=150701 5* 03I am islptng 5* (+590) 10/* */
> 1737889450 629481 PRIVMSG #esolangs :14[[07Poetic LOLWICNETP14]]4 10 02https://esolangs.org/w/index.php?diff=150824&oldid=142185 5* 03Unname4798 5* (-95) 10
> 1737890147 497630 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150825&oldid=150820 5* 03Unname4798 5* (+265) 10
> 1737890185 586391 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150826&oldid=150825 5* 03Unname4798 5* (+1) 10/* Type 29 */
> 1737890269 792575 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150827&oldid=150826 5* 03Unname4798 5* (+21) 10
> 1737890440 114149 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150828&oldid=150827 5* 03Unname4798 5* (+10) 10
> 1737890740 584728 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150829&oldid=150828 5* 03Unname4798 5* (+283) 10/* Type 29 */
> 1737891025 159728 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150830&oldid=150829 5* 03I am islptng 5* (-580) 10Please ask PSTF or None1 to allow you to contribute, Unname4798!
> 1737891441 57113 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150831&oldid=150830 5* 03Unname4798 5* (-159) 10Everyone is now free to contribute !
> 1737891478 208949 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150832&oldid=150831 5* 03Unname4798 5* (+739) 10correcting the page
> 1737892236 346447 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150833&oldid=150823 5* 03PrySigneToFry 5* (+914) 10
> 1737892536 635457 PRIVMSG #esolangs :14[[07NOR Machine14]]4 10 02https://esolangs.org/w/index.php?diff=150834&oldid=150617 5* 03PrySigneToFry 5* (+28) 10
< 1737893067 212122 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737893182 527289 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1737893330 697187 PRIVMSG #esolangs :14[[07Combinatory logic14]]4 10 02https://esolangs.org/w/index.php?diff=150835&oldid=146889 5* 03Pro465 5* (+12) 10/* SKI calculus */ add original name of S combinator
> 1737893706 783717 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150836&oldid=150832 5* 03PrySigneToFry 5* (+1847) 10
> 1737893734 426885 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150837&oldid=150836 5* 03PrySigneToFry 5* (+1) 10
> 1737893965 804631 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150838&oldid=150698 5* 03PrySigneToFry 5* (+206) 10
> 1737894395 293766 PRIVMSG #esolangs :14[[07Combinatory logic14]]4 10 02https://esolangs.org/w/index.php?diff=150839&oldid=150835 5* 03Pro465 5* (+211) 10/* External resources */ add Moses (1924) paper
< 1737894660 717288 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl QUIT :Remote host closed the connection
> 1737895706 275856 PRIVMSG #esolangs :14[[07NOR Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150840&oldid=150834 5* 03Unname4798 5* (-3) 10AND gate is certainly correct.
> 1737895832 909168 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150841&oldid=150837 5* 03Unname4798 5* (-1) 10/* Alternated introduction */
> 1737895970 542907 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150842&oldid=150841 5* 03Unname4798 5* (-52) 10/* Alternate introduction */
> 1737896211 634303 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150843&oldid=150842 5* 03Unname4798 5* (+278) 10/* Type 34 */
< 1737896268 412629 :Sgeo_!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737896639 284228 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150844&oldid=150815 5* 03Blashyrkh 5* (+268) 10Time complexity
> 1737896883 601234 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150845&oldid=150844 5* 03Blashyrkh 5* (+25) 10
> 1737897574 618579 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150846&oldid=150845 5* 03Blashyrkh 5* (+11) 10
> 1737898415 750379 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=150847&oldid=149474 5* 03PrySigneToFry 5* (+63) 10
> 1737899073 816954 PRIVMSG #esolangs :14[[07User talk:Tommyaweosmalt14]]4 N10 02https://esolangs.org/w/index.php?oldid=150848 5* 03PrySigneToFry 5* (+471) 10/* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */ new section
> 1737899590 550308 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150849&oldid=150843 5* 03PkmnQ 5* (+887) 10/* Dialects created in 2025 */ [[Recursive]] derivatives
< 1737899894 513430 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737900111 890155 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150850&oldid=150849 5* 03Unname4798 5* (-196) 10/* Dialects created in 2025 */
> 1737900146 114602 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150851&oldid=150850 5* 03Unname4798 5* (+196) 10Undo revision [[Special:Diff/150850|150850]] by [[Special:Contributions/Unname4798|Unname4798]] ([[User talk:Unname4798|talk]])
> 1737900668 375313 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150852&oldid=150851 5* 03PkmnQ 5* (+17) 10forgot to add this
> 1737901144 789492 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150853&oldid=150852 5* 03PrySigneToFry 5* (+685) 10
> 1737901250 480335 PRIVMSG #esolangs :14[[07Recursive14]]4 10 02https://esolangs.org/w/index.php?diff=150854&oldid=139785 5* 03PkmnQ 5* (+241) 10/* See also */
> 1737901656 232211 PRIVMSG #esolangs :14[[07DeleteScript14]]4 10 02https://esolangs.org/w/index.php?diff=150855&oldid=116124 5* 03PrySigneToFry 5* (+287) 10
> 1737904786 35311 PRIVMSG #esolangs :14[[07TM14]]4 10 02https://esolangs.org/w/index.php?diff=150856&oldid=150821 5* 03I am islptng 5* (+132) 10
> 1737904851 231594 PRIVMSG #esolangs :14[[07Huit14]]4 M10 02https://esolangs.org/w/index.php?diff=150857&oldid=137676 5* 03TheCanon2 5* (+59) 10
> 1737905164 337653 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150858&oldid=150853 5* 03I am islptng 5* (+447) 10/* Type 40 */
> 1737905194 451617 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150859&oldid=150858 5* 03I am islptng 5* (+4) 10/* Turing-complete */
> 1737905655 803197 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150860&oldid=150774 5* 03Buckets 5* (+9) 10
> 1737905665 399160 PRIVMSG #esolangs :14[[07-114]]4 N10 02https://esolangs.org/w/index.php?oldid=150861 5* 03Buckets 5* (+1889) 10Created page with "-1 is An esoteric programming language, where [[User:Buckets]] found out -1 hasn't been created yet, So [[User:Buckets]] just thought of random idea for this esolang, "What if the code was Tables?" The most awful idea, That took 3 days to Complete just the Commands. The code
> 1737905726 123868 PRIVMSG #esolangs :14[[07User:Buckets14]]4 10 02https://esolangs.org/w/index.php?diff=150862&oldid=150305 5* 03Buckets 5* (+9) 10
> 1737905766 29122 PRIVMSG #esolangs :14[[07-114]]4 M10 02https://esolangs.org/w/index.php?diff=150863&oldid=150861 5* 03Buckets 5* (+9) 10
> 1737905883 865861 PRIVMSG #esolangs :14[[07-114]]4 M10 02https://esolangs.org/w/index.php?diff=150864&oldid=150863 5* 03Buckets 5* (+38) 10
> 1737906734 741565 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=150865&oldid=150686 5* 03DGCK81LNN 5* (+93) 10/* Example programs */
< 1737906776 967620 :molson!~molson@2605-4A80-2101-99D0-7337-7CBF-8530-BD25-dynamic.midco.net JOIN #esolangs molson :realname
< 1737906913 13553 :molson_!~molson@2605-4A80-2101-99D0-D106-1E39-2E45-4C88-dynamic.midco.net QUIT :Ping timeout: 252 seconds
< 1737907122 431356 :fungot!~fungot@2a01:4b00:82bb:1341::a QUIT :Ping timeout: 246 seconds
> 1737908679 245277 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150866&oldid=150793 5* 03Calculus is fun 5* (+200) 10/* 99 bottles of beer */
< 1737908711 992979 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: https://github.com/Nakazoto/UEVTC/wiki has some more info about the vacuum tube computer that Usagi Electronics is building, but that info is described as out of date. there's a new video https://www.youtube.com/watch?v=z4KVNAmwND8 which declares the computer build finished
> 1737909172 505808 PRIVMSG #esolangs :14[[07Esolang talk:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150867&oldid=150795 5* 03Ais523 5* (+537) 10/* Category for esoteric supersets */ why I think that would be a bad idea
> 1737909685 851438 PRIVMSG #esolangs :14[[07The last line of this page14]]4 N10 02https://esolangs.org/w/index.php?oldid=150868 5* 03PkmnQ 5* (+3921) 10Created page with "{{Wrongtitle|title=[[Category:No-code esolang]] [[Category:Unimplemented]]}} [[The last line of this page|[[Category:No-code esolang]] [[Category:Unimplemented]]]] is a [[:Category:No-code esolang|no-code esolang]]. How
> 1737909877 659055 PRIVMSG #esolangs :14[[07UE114]]4 N10 02https://esolangs.org/w/index.php?oldid=150869 5* 03B jonas 5* (+451) 10Created page with "The '''UE1''' or '''UE-1''' is a homebrew retro hardware computer built by Usagi Electric between 2020 and 2025 from vacuum tubes (thermionic valves). == Links == * [https://www.youtube.com/playlist?list=PLnw98JPyObn0v-98gRV9PfzAQONTKxql3 Video series of the construction
> 1737909885 243773 PRIVMSG #esolangs :14[[07Talk:-114]]4 N10 02https://esolangs.org/w/index.php?oldid=150870 5* 03PkmnQ 5* (+253) 10Created page with "Kind of surprised this wasn't taken earlier. I noticed and had a plan for this a while ago, but I couldn't find a way to make it work. Nice to finally see an esolang named -1. -~~~~"
> 1737910227 8195 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=150871&oldid=150397 5* 03PkmnQ 5* (+175) 10/* General languages */ [[Recursive]] and [[The last line of this page|[[Category:No-code esolang]] [[Category:Unimplemented]]]]
> 1737910321 81798 PRIVMSG #esolangs :14[[07User:B jonas/List14]]4 10 02https://esolangs.org/w/index.php?diff=150872&oldid=139041 5* 03B jonas 5* (+86) 10UE1
> 1737910334 540779 PRIVMSG #esolangs :14[[07User:B jonas14]]4 10 02https://esolangs.org/w/index.php?diff=150873&oldid=150716 5* 03B jonas 5* (-190) 10/* Todo */
< 1737910365 548028 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I don't think I'm going to learn more about this one so it's best to just create a stub page with a pointer
> 1737910744 331875 PRIVMSG #esolangs :14[[07Action symbol14]]4 10 02https://esolangs.org/w/index.php?diff=150874&oldid=144458 5* 03Yayimhere2(school) 5* (-1) 10/* how it works */
> 1737910962 309851 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150875&oldid=150620 5* 03Dmiz 5* (+515) 10
> 1737911009 677596 PRIVMSG #esolangs :14[[07DeleteScript14]]4 10 02https://esolangs.org/w/index.php?diff=150876&oldid=150855 5* 0347 5* (-11) 10/* Another method in Windows */
> 1737911065 639741 PRIVMSG #esolangs :14[[07User talk:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=150877&oldid=150848 5* 0347 5* (+77) 10
> 1737911219 873124 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150878&oldid=150746 5* 03Unname4798 5* (+846) 10
> 1737911260 757179 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=150879&oldid=150111 5* 0347 5* (+44) 10/* Implementations */
> 1737911324 328122 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=150880&oldid=150879 5* 0347 5* (+0) 10welcome back old formula
> 1737911375 602330 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150881&oldid=150878 5* 03Unname4798 5* (-1) 10
> 1737911583 769907 PRIVMSG #esolangs :14[[07User talk:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=150882&oldid=150877 5* 0347 5* (-3) 10/* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */
> 1737911604 530419 PRIVMSG #esolangs :14[[07User:B jonas/List14]]4 10 02https://esolangs.org/w/index.php?diff=150883&oldid=150872 5* 03B jonas 5* (+145) 10+[[Scrip7]]
> 1737911645 348274 PRIVMSG #esolangs :14[[07User talk:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=150884&oldid=150882 5* 0347 5* (+329) 10/* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */ added Unname's thing
> 1737911725 268039 PRIVMSG #esolangs :14[[07User talk:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=150885&oldid=150884 5* 0347 5* (+1) 10/* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */
> 1737912637 950808 PRIVMSG #esolangs :14[[07-114]]4 10 02https://esolangs.org/w/index.php?diff=150886&oldid=150864 5* 03Hakerh400 5* (+33) 10Add the "See also" section
> 1737912754 360525 PRIVMSG #esolangs :14[[07Imprecision14]]4 10 02https://esolangs.org/w/index.php?diff=150887&oldid=137737 5* 03Hakerh400 5* (+20) 10Add a similar esolang to the "See also" section
< 1737912970 233878 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737912981 219934 :craigo!~craigo@user/craigo QUIT :Read error: Connection reset by peer
< 1737913029 464411 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737915255 339892 PRIVMSG #esolangs :14[[07GD auto level14]]4 10 02https://esolangs.org/w/index.php?diff=150888&oldid=138746 5* 03Unname4798 5* (+1161) 10the official version of [[Gd auto level]]
> 1737915318 148485 PRIVMSG #esolangs :14[[07GD auto level14]]4 M10 02https://esolangs.org/w/index.php?diff=150889&oldid=150888 5* 03Unname4798 5* (+2) 10(I mean the page, not the model itself)
> 1737915403 841096 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150890&oldid=150881 5* 03Unname4798 5* (-845) 10delete an attempt to host user talk pages somewhere else
< 1737915455 681121 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1737915486 415175 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1737915640 215183 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737915673 492518 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737915991 467263 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
> 1737918023 112831 PRIVMSG #esolangs :14[[07Fuck 2red14]]4 N10 02https://esolangs.org/w/index.php?oldid=150891 5* 03Tommyaweosme 5* (+574) 10Created page with "Fuck 2red is an esolang created by [[user:tommyaweosme]] after he got banned on pixilart == commands == commands are stacks of "fuck 2red" seperated by "Fuck 2red" 1 + 2 - 3 > 4 < 5 . 6 , 7 [ 8 ] == cat == fuck 2red fuck 2red fuck 2red fuck 2red fuck 2red
> 1737918097 110305 PRIVMSG #esolangs :14[[07GD auto level14]]4 10 02https://esolangs.org/w/index.php?diff=150892&oldid=150889 5* 03Tommyaweosme 5* (-1163) 10literally a copy
> 1737919790 577835 PRIVMSG #esolangs :14[[07Talk:Fuck 2red14]]4 N10 02https://esolangs.org/w/index.php?oldid=150893 5* 0347 5* (+69) 10Created page with "how did you got banned in pixelart of all things~~~"
< 1737919797 86528 :APic!apic@apic.name PRIVMSG #esolangs :cu
> 1737919818 400687 PRIVMSG #esolangs :14[[07Talk:Fuck 2red14]]4 10 02https://esolangs.org/w/index.php?diff=150894&oldid=150893 5* 0347 5* (+0) 10
> 1737920138 970579 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150895&oldid=150776 5* 0347 5* (+13) 10/* Stuff to continue */
> 1737921282 264270 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150896&oldid=150866 5* 03Calculus is fun 5* (+6) 10/* Behavior */
> 1737921461 14440 PRIVMSG #esolangs :14[[07LJAPL14]]4 10 02https://esolangs.org/w/index.php?diff=150897&oldid=146249 5* 0347 5* (+484) 10
> 1737921486 891365 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150898&oldid=150895 5* 0347 5* (-11) 10/* Stuff to continue */
> 1737921517 933306 PRIVMSG #esolangs :14[[07MoreMathRPN/Brainfuck interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=150899&oldid=150408 5* 03Calculus is fun 5* (+50) 10Self-Interpreter is command.
> 1737921581 748250 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150900&oldid=150639 5* 0347 5* (+32) 10/* Esolangs */
< 1737923100 705186 :ski!~ski@remote11.chalmers.se QUIT :Quit: Lost terminal
> 1737924923 429696 PRIVMSG #esolangs :14[[07Talk:Fuck 2red14]]4 10 02https://esolangs.org/w/index.php?diff=150901&oldid=150894 5* 03Tommyaweosme 5* (+306) 10
< 1737925130 640929 :Guest57!~Guest57@m213-103-192-10.cust.tele2.lt JOIN #esolangs * :[https://web.libera.chat] Guest57
< 1737925313 597743 :Guest57!~Guest57@m213-103-192-10.cust.tele2.lt QUIT :Client Quit
< 1737925589 471343 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737927348 950962 :chomwitt!~alex@ppp-94-67-189-44.home.otenet.gr QUIT :Ping timeout: 245 seconds
> 1737927872 835484 PRIVMSG #esolangs :14[[07LJAPL14]]4 10 02https://esolangs.org/w/index.php?diff=150902&oldid=150897 5* 03Calculus is fun 5* (+164) 10Hello world
> 1737928985 159104 PRIVMSG #esolangs :14[[07LJAPL14]]4 10 02https://esolangs.org/w/index.php?diff=150903&oldid=150902 5* 03Calculus is fun 5* (+2742) 10Added MoreMathRPN esointerpreter
> 1737929140 981668 PRIVMSG #esolangs :14[[07LJAPL14]]4 M10 02https://esolangs.org/w/index.php?diff=150904&oldid=150903 5* 03Calculus is fun 5* (+37) 10/* Hello world */
> 1737929800 35603 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150905&oldid=150880 5* 03Calculus is fun 5* (+15) 10added pseudocode
> 1737929846 366092 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150906&oldid=150905 5* 03Calculus is fun 5* (+1) 10/* MoreMathRPN */
< 1737931302 412849 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :yeah, there's very little info there so it won't help
> 1737931312 397610 PRIVMSG #esolangs :14[[07Esolang:Help14]]4 10 02https://esolangs.org/w/index.php?diff=150907&oldid=142045 5* 03Calculus is fun 5* (+350) 10How to do tables
> 1737931498 756778 PRIVMSG #esolangs :14[[07Esolang:Help14]]4 10 02https://esolangs.org/w/index.php?diff=150908&oldid=150907 5* 03Calculus is fun 5* (+66) 10/* Text formatting and organization */
> 1737931528 770155 PRIVMSG #esolangs :14[[07Esolang:Help14]]4 M10 02https://esolangs.org/w/index.php?diff=150909&oldid=150908 5* 03Calculus is fun 5* (-8) 10/* Text formatting and organization */
> 1737931598 216467 PRIVMSG #esolangs :14[[07Esolang:Help14]]4 M10 02https://esolangs.org/w/index.php?diff=150910&oldid=150909 5* 03Calculus is fun 5* (+0) 10/* Tables */
> 1737934842 166886 PRIVMSG #esolangs :14[[07Talk:Segreq14]]4 M10 02https://esolangs.org/w/index.php?diff=150911&oldid=77658 5* 03Calculus is fun 5* (+114) 10expression name question
> 1737934864 425314 PRIVMSG #esolangs :14[[07Talk:Segreq14]]4 M10 02https://esolangs.org/w/index.php?diff=150912&oldid=150911 5* 03Calculus is fun 5* (+107) 10/* Naming */
< 1737936166 538800 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737936246 494133 :molson_!~molson@2605-4A80-2101-99D0-7337-7CBF-8530-BD25-dynamic.midco.net JOIN #esolangs molson :realname
< 1737936362 373412 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737936486 897043 :molson!~molson@2605-4A80-2101-99D0-7337-7CBF-8530-BD25-dynamic.midco.net QUIT :Ping timeout: 272 seconds
< 1737937991 634875 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1737938091 344916 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
> 1737939098 260304 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 M10 02https://esolangs.org/w/index.php?diff=150913&oldid=150796 5* 03Somefan 5* (+29) 10
< 1737940653 641807 :somefan!~somefan@208.58.192.69 JOIN #esolangs * :[https://web.libera.chat] somefan
< 1737940839 671215 :somefan!~somefan@208.58.192.69 PRIVMSG #esolangs :LO
< 1737941092 323124 :somefan!~somefan@208.58.192.69 PRIVMSG #esolangs :first time using irc
< 1737941513 14996 :somefan!~somefan@208.58.192.69 PRIVMSG #esolangs :for messaging
< 1737941534 53931 :somefan!~somefan@208.58.192.69 QUIT :Quit: Client closed
< 1737942418 456441 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737943841 398903 PRIVMSG #esolangs :14[[07User:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150914&oldid=150608 5* 03PrySigneToFry 5* (+91) 10
> 1737943926 483331 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150915&oldid=150890 5* 03PrySigneToFry 5* (-2) 10
> 1737944093 338541 PRIVMSG #esolangs :14[[07DeleteScript14]]4 10 02https://esolangs.org/w/index.php?diff=150916&oldid=150876 5* 03PrySigneToFry 5* (+39) 10
> 1737945617 594507 PRIVMSG #esolangs :14[[07User:Tommyaweosme14]]4 M10 02https://esolangs.org/w/index.php?diff=150917&oldid=150914 5* 03Tommyaweosme 5* (-107) 10restore
< 1737947276 480238 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds
> 1737947929 189200 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150918&oldid=148352 5* 03PrySigneToFry 5* (+3) 10Fixed command for the cat program.
> 1737961338 530140 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150919&oldid=150915 5* 03Ractangle 5* (+2) 10oh no you don't
< 1737962399 671646 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737963870 612452 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
< 1737965682 796697 :xelxebar_!~xelxebar@wilsonb.com QUIT :Quit: ZNC 1.7.2+deb3 - https://znc.in
< 1737965754 370932 :xelxebar!~xelxebar@wilsonb.com JOIN #esolangs xelxebar :ZNC - https://znc.in
> 1737965963 596246 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03NMNS 5* 10New user account
> 1737968238 586889 PRIVMSG #esolangs :14[[07User:Blashyrkh/Kolakoski-brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=150920&oldid=150846 5* 03Blashyrkh 5* (-10) 10minor comment fix
> 1737970155 481043 PRIVMSG #esolangs :14[[07Talk:BOREDOM14]]4 10 02https://esolangs.org/w/index.php?diff=150921&oldid=148246 5* 03PrySigneToFry 5* (+882) 10/* It just like... */ new section
> 1737971069 667744 PRIVMSG #esolangs :14[[07Talk:BOREDOM14]]4 10 02https://esolangs.org/w/index.php?diff=150922&oldid=150921 5* 03PrySigneToFry 5* (+125) 10
> 1737971200 468643 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150923&oldid=150919 5* 03PrySigneToFry 5* (-2) 10I had to, because this user had almost no impression of me.
> 1737971311 204357 PRIVMSG #esolangs :14[[07User:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150924&oldid=150917 5* 03PrySigneToFry 5* (+198) 10
> 1737971596 295514 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150925&oldid=150859 5* 03PrySigneToFry 5* (+73) 10
> 1737971783 445673 PRIVMSG #esolangs :14[[07UserEdited14]]4 10 02https://esolangs.org/w/index.php?diff=150926&oldid=149353 5* 03PrySigneToFry 5* (+296) 10
< 1737972205 313696 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1737972476 427007 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737972605 276028 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150927&oldid=150925 5* 03PrySigneToFry 5* (+2226) 10
> 1737972687 602133 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150928&oldid=150691 5* 03PrySigneToFry 5* (+892) 10/* */ new section
< 1737978180 299403 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737979354 455563 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1737979540 254700 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737979960 518269 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150929&oldid=150923 5* 03Unname4798 5* (-35) 10deleting PrySigneToFry from the warsides
> 1737980066 741876 PRIVMSG #esolangs :14[[0714]]4 N10 02https://esolangs.org/w/index.php?oldid=150930 5* 03PrySigneToFry 5* (+2398) 10Created page with "{{WIP}} is an Esolang designed by PSTF. It is Chinese version of [[]](?). The author also inspired from the wasted Esolang GaoErFu by islptng and [[Sclipting]] by Timwi. = Language Overview = Everything is like except: ... -- ... -- -- ... -- ... --
> 1737980106 578443 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150931&oldid=150860 5* 03PrySigneToFry 5* (+10) 10
> 1737980410 74045 PRIVMSG #esolangs :14[[07Trigger14]]4 10 02https://esolangs.org/w/index.php?diff=150932&oldid=20055 5* 03Unname4798 5* (-160) 10
> 1737980418 509619 PRIVMSG #esolangs :14[[07Trigger14]]4 10 02https://esolangs.org/w/index.php?diff=150933&oldid=150932 5* 03Unname4798 5* (+160) 10Undo revision [[Special:Diff/150932|150932]] by [[Special:Contributions/Unname4798|Unname4798]] ([[User talk:Unname4798|talk]])
> 1737981197 740593 PRIVMSG #esolangs :14[[07GD auto level14]]4 10 02https://esolangs.org/w/index.php?diff=150934&oldid=150892 5* 03Unname4798 5* (+1163) 10Undo revision [[Special:Diff/150892|150892]] by [[Special:Contributions/Tommyaweosme|Tommyaweosme]] ([[User talk:Tommyaweosme|talk]]) (not entirely a copy)
> 1737981846 672123 PRIVMSG #esolangs :14[[07UserEdited14]]4 M10 02https://esolangs.org/w/index.php?diff=150935&oldid=150926 5* 03Unname4798 5* (+3) 10
< 1737983647 427611 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1737985268 484366 PRIVMSG #esolangs :14[[07User:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150936&oldid=150924 5* 03Ais523 5* (-198) 10Undo revision [[Special:Diff/150924|150924]] by [[Special:Contributions/PrySigneToFry|PrySigneToFry]] ([[User talk:PrySigneToFry|talk]]) too large an edit to be appropriate to be making to a different user's userpage
< 1737986522 440226 :chomwitt!~alex@2a02:587:7a26:6500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737987364 827765 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Excess Flood
< 1737987448 434465 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737988175 473920 :ski!~ski@remote11.chalmers.se JOIN #esolangs ski :Stefan Ljungstrand
> 1737988301 434466 PRIVMSG #esolangs :14[[07Esolang:Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150937&oldid=149134 5* 03PrySigneToFry 5* (-2) 10
> 1737988544 812992 PRIVMSG #esolangs :14[[07Esolang:Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150938&oldid=150937 5* 03PrySigneToFry 5* (+3769) 10Will Esolang Wiki display the historical glyphs(such as Cuneiforms) well?
> 1737988573 896935 PRIVMSG #esolangs :14[[07Esolang:Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150939&oldid=150938 5* 03PrySigneToFry 5* (-3769) 10OK it can, so I had to clean up the sandbox!
< 1737989451 457702 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737989613 825771 :craigo!~craigo@user/craigo QUIT :Client Quit
< 1737989665 968152 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737992519 122384 PRIVMSG #esolangs :14[[07Smasnug14]]4 10 02https://esolangs.org/w/index.php?diff=150940&oldid=150622 5* 03Win7HE 5* (+65) 10/* the new smaooong commands */
> 1737992578 247365 PRIVMSG #esolangs :14[[07Smasnug14]]4 10 02https://esolangs.org/w/index.php?diff=150941&oldid=150940 5* 03Win7HE 5* (+60) 10
> 1737992701 563121 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150942&oldid=150929 5* 03Unname4798 5* (+30) 10
> 1737996212 959700 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150943&oldid=150833 5* 03YufangTSTSU 5* (+96) 10/* Any interests on joining our Esolang Tencent QQ group? */ new section
> 1737996228 987077 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 M10 02https://esolangs.org/w/index.php?diff=150944&oldid=150943 5* 03YufangTSTSU 5* (+97) 10
< 1738001976 19711 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738002027 418065 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1738002059 742817 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1738005370 316558 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1738007125 442074 PRIVMSG #esolangs :14[[07Useful brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=150945&oldid=125622 5* 03Kaveh Yousefi 5* (+619) 10Introduced two further example programs, added a hyperlink to my implementation on GitHub, and supplemented the page category tag Implemented.
> 1738010217 9663 PRIVMSG #esolangs :14[[07Talk:GD auto level14]]4 N10 02https://esolangs.org/w/index.php?oldid=150946 5* 03Tommyaweosme 5* (+566) 10Created page with "this is a carbon copy, attributed to me and the only change is the capitalization. no this is not the official one, and this page never should have been created in the first place. and remember, you attributed it to me so i can delete my attributed work o
< 1738011786 430580 :chomwitt!~alex@2a02:587:7a26:6500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 246 seconds
> 1738012880 180212 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150947&oldid=150875 5* 03Dmiz 5* (+6) 10
> 1738015858 714774 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150948&oldid=150947 5* 03Dmiz 5* (+2620) 10
< 1738016839 478541 :molson_!~molson@2605-4A80-2101-99D0-7337-7CBF-8530-BD25-dynamic.midco.net QUIT :Ping timeout: 260 seconds
> 1738016895 898317 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150949&oldid=150948 5* 03Dmiz 5* (+17) 10
< 1738017294 87743 :APic!apic@apic.name PRIVMSG #esolangs :Good Night
< 1738020058 210984 :chomwitt!~alex@2a02:587:7a26:6500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1738020447 190115 :chomwitt!~alex@2a02:587:7a26:6500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
> 1738021680 605088 PRIVMSG #esolangs :14[[07Password generator14]]4 N10 02https://esolangs.org/w/index.php?oldid=150950 5* 03Dmiz 5* (+284) 10Created page with "The Password generator is a Program created by ~~~
this program test this program tests: *randomness *input *output *loop the program prompts for input:
print a random letter from a to z
repeat the last command of the input"
> 1738021722 559264 PRIVMSG #esolangs :14[[07Password generator14]]4 10 02https://esolangs.org/w/index.php?diff=150951&oldid=150950 5* 03Dmiz 5* (+27) 10
< 1738022647 210737 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1738022770 998429 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1738022930 408004 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1738024582 88538 PRIVMSG #esolangs :14[[07Talk:GD auto level14]]4 10 02https://esolangs.org/w/index.php?diff=150952&oldid=150946 5* 03Ais523 5* (+338) 10derivative pages should be about the derivative, rather than necessarily copying everything from the original language page
> 1738028954 383889 PRIVMSG #esolangs :14[[07User:Tommyaweosme/albuquerque hexdump14]]4 N10 02https://esolangs.org/w/index.php?oldid=150953 5* 03Tommyaweosme 5* (+18622) 10Created page with "576179206261636b207768656e204920776173206a7573742061206c6974746c6520626974747920626f79 4c6976696e6720696e206120626f7820756e6465722074686520737461697273 496e2074686520636f726e6572206f662074686520626173656d656e74206f662074686520686
> 1738029048 213742 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150954&oldid=150944 5* 03PrySigneToFry 5* (+990) 10
< 1738029929 175961 :Melvar!~melvar@dslb-088-070-034-244.088.070.pools.vodafone-ip.de QUIT :Ping timeout: 252 seconds
> 1738029954 527320 PRIVMSG #esolangs :14[[07User talk:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150955&oldid=149612 5* 03PrySigneToFry 5* (+0) 10p
> 1738030650 200009 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150956&oldid=150949 5* 03Dmiz 5* (+10) 10
< 1738030731 443927 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1738031045 518333 :Melvar!~melvar@dslb-084-063-063-254.084.063.pools.vodafone-ip.de JOIN #esolangs Melvar :melvar
> 1738038342 484591 PRIVMSG #esolangs :14[[07IBSA14]]4 10 02https://esolangs.org/w/index.php?diff=150957&oldid=122744 5* 03Simple9371 5* (+120) 10/* Flow definition */ Added clarifications
> 1738038443 601295 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150958&oldid=150957 5* 03Simple9371 5* (+6) 10/* Flow definition */
> 1738038531 880608 PRIVMSG #esolangs :14[[07User talk:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150959&oldid=150955 5* 03I am islptng 5* (+0) 10 is used for "False" so I have to use .
< 1738039048 955859 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de QUIT :Ping timeout: 245 seconds
< 1738039274 901073 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1738039903 21554 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de JOIN #esolangs * :rodgort
> 1738041850 905501 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150960&oldid=150958 5* 03Simple9371 5* (+2) 10/* Flow definition */
> 1738042985 437490 PRIVMSG #esolangs :14[[07User:I am islptng/SingleOperandAssembly14]]4 N10 02https://esolangs.org/w/index.php?oldid=150961 5* 03I am islptng 5* (+806) 10Created page with "== Instructions == The RISC has 16 instructions, each of them has exactly 1 operand. The computer has a register to store the result of calculations. {|class=wikitable ! Hex !! Keyword !! Meaning |- | 0 || imd x || reg = x |- | 1 ||
> 1738043048 446094 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150962&oldid=150960 5* 03Simple9371 5* (-60) 10/* Flow definition */
> 1738043861 19724 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150963&oldid=150962 5* 03Simple9371 5* (-25) 10/* Flow definition */
> 1738044394 796337 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150964&oldid=150963 5* 03Simple9371 5* (-5) 10/* Flow definition */
> 1738045101 452505 PRIVMSG #esolangs :14[[07X bottles of beers, take y down, x and y are in Real Numbers Set14]]4 10 02https://esolangs.org/w/index.php?diff=150965&oldid=134366 5* 03PrySigneToFry 5* (+123) 10
> 1738045469 495124 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150966&oldid=150930 5* 03PrySigneToFry 5* (+255) 10
> 1738045489 281859 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150967&oldid=150966 5* 03PrySigneToFry 5* (+1) 10
> 1738045567 911655 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150968&oldid=150967 5* 03PrySigneToFry 5* (+186) 10
> 1738046488 471983 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150969&oldid=150964 5* 03Simple9371 5* (+1) 10/* Computational class */ converted > translated
> 1738047056 120416 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150970&oldid=150969 5* 03Simple9371 5* (-4) 10/* Flow definition */ Remove 'now'
> 1738047174 245123 PRIVMSG #esolangs :14[[07IBSA14]]4 M10 02https://esolangs.org/w/index.php?diff=150971&oldid=150970 5* 03Simple9371 5* (-4) 10/* Flow definition */ Oops
> 1738049308 442431 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=150972&oldid=149845 5* 03WinslowJosiah 5* (+84) 10Add Truth-machine in Bespoke
< 1738051700 851100 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1738053908 289629 PRIVMSG #esolangs :14[[07User:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150973&oldid=148968 5* 03PrySigneToFry 5* (+319) 10
< 1738059612 639546 :APic!apic@apic.name PRIVMSG #esolangs :Moin
> 1738062833 834448 PRIVMSG #esolangs :14[[07Zyxonia/Libraries14]]4 N10 02https://esolangs.org/w/index.php?oldid=150974 5* 03PrySigneToFry 5* (+1194) 10Created page with "{{Back|Zyxonia}} Zyxonia has lots of libraries. They often used to make more functions, and do special things in Zyxonia. Here are some useful libraries. == MATH == This library provides mathematical calculations. SIN a COS a TAN a COT a SEC a C
> 1738062917 682689 PRIVMSG #esolangs :14[[07Zyxonia14]]4 10 02https://esolangs.org/w/index.php?diff=150975&oldid=150813 5* 03PrySigneToFry 5* (+57) 10
< 1738065779 983156 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1738065945 655296 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1738075688 871995 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150976&oldid=149867 5* 03I am islptng 5* (+7539) 1099% by Deepseek AI!
< 1738078978 230912 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1738088397 902579 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738088460 1862 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 260 seconds
< 1738088564 61387 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 QUIT :Excess Flood
< 1738088867 452844 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1738089695 946215 PRIVMSG #esolangs :14[[07Demlang14]]4 N10 02https://esolangs.org/w/index.php?oldid=150977 5* 03Cocosbeans 5* (+2628) 10Created page with "[[Category:2025]] [[Category:Joke_languages]] [[Category:Languages]] [[Category:Unimplemented]] '''Demlang''' is an object-oriented joke language created by [[User:Cocosbeans]] in 2025. The concept of the language is that any data created in a file, including variabl
< 1738090864 511916 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 QUIT :Ping timeout: 260 seconds
< 1738090864 583744 :pikhq!sid394595@user/meow/pikhq QUIT :Ping timeout: 260 seconds
< 1738090899 740243 :dnm!sid401311@id-401311.lymington.irccloud.com QUIT :Ping timeout: 260 seconds
< 1738090899 820999 :voxpelli!sid31634@id-31634.tinside.irccloud.com QUIT :Ping timeout: 260 seconds
< 1738090934 853764 :Lymia!lymia@ayame.servers.aura.moe QUIT :Ping timeout: 260 seconds
< 1738090935 123525 :integral!sid296274@user/integral QUIT :Ping timeout: 260 seconds
< 1738090956 426167 :Lymia!lymia@ayame.servers.aura.moe JOIN #esolangs Lymia :Lymia Aluysia
< 1738091014 229257 :dnm!sid401311@id-401311.lymington.irccloud.com JOIN #esolangs dnm :dnm
< 1738091017 65877 :voxpelli!sid31634@id-31634.tinside.irccloud.com JOIN #esolangs voxpelli :Pelle Wessman
< 1738091020 648453 :integral!sid296274@user/integral JOIN #esolangs integral :bsmith
< 1738091031 213356 :pikhq!sid394595@user/meow/pikhq JOIN #esolangs pikhq :Ada Worcester
> 1738093689 792918 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150978&oldid=150956 5* 03Dmiz 5* (+69) 10
> 1738097502 919919 PRIVMSG #esolangs :14[[07User:Jan jelo/My fourth BF quine14]]4 N10 02https://esolangs.org/w/index.php?oldid=150979 5* 03Jan jelo 5* (+3859) 10Created page with "The following is a [[Quine]] by [[User:Jan jelo]] in [[Brainfuck]],requires negative indexes: >++++>++>+>++>+>+>++++>++++>+>++>+++>+>++++>++>+>++++>++>+>+>+>+>++>+>+>++>+>+>+>+>+++>++>+>+>+>+>+++>++>+++>+>++>+++>+>++>++
< 1738099330 402514 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1738101745 271578 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1738102278 624249 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Quit: Laa shay'a waqi'un moutlaq bale kouloun moumkine
< 1738102300 399238 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738102361 723500 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1738103431 380223 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
> 1738105266 493068 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150980&oldid=150978 5* 03Dmiz 5* (+29) 10
> 1738105375 434874 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150981&oldid=150980 5* 03Dmiz 5* (+4) 10
< 1738106017 442920 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1738109045 130422 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1738109183 999469 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1738113539 484380 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 JOIN #esolangs Corbin :korvo
< 1738116755 904456 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1738121139 418362 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150982&oldid=150968 5* 03PrySigneToFry 5* (+16) 10
< 1738122467 312537 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam
< 1738123230 453220 :molson!~molson@2605-4A80-2101-99D0-8D58-8776-9CE3-CAF5-dynamic.midco.net JOIN #esolangs molson :realname
> 1738124220 651935 PRIVMSG #esolangs :14[[07User:Jan jelo/My fourth BF quine14]]4 M10 02https://esolangs.org/w/index.php?diff=150983&oldid=150979 5* 03Jan jelo 5* (+2) 10
> 1738124258 521802 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150984&oldid=150614 5* 03Jan jelo 5* (+38) 10/* Other */
> 1738124635 359114 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150985&oldid=150976 5* 03I am islptng 5* (-6412) 10Manual translation and edit.
< 1738126752 902199 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 272 seconds
< 1738127208 472920 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1738130104 664096 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
> 1738132022 101108 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150986&oldid=150982 5* 03PrySigneToFry 5* (+455) 10
< 1738132031 871456 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity
> 1738134958 341703 PRIVMSG #esolangs :14[[07ReverseFuck14]]4 10 02https://esolangs.org/w/index.php?diff=150987&oldid=139265 5* 03PrySigneToFry 5* (+15) 10Make more people can understand
> 1738135138 679473 PRIVMSG #esolangs :14[[07VERPNL14]]4 10 02https://esolangs.org/w/index.php?diff=150988&oldid=148767 5* 03PrySigneToFry 5* (+54) 10
> 1738135512 877822 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=150989&oldid=150053 5* 03PrySigneToFry 5* (+541) 10
> 1738135752 385883 PRIVMSG #esolangs :14[[07User talk:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150990&oldid=148905 5* 03PrySigneToFry 5* (+1845) 10
< 1738138079 886096 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1738138919 377522 :craigo!~craigo@user/craigo QUIT :Ping timeout: 260 seconds
> 1738139095 420302 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 031llCodeAnything 5* 10New user account
< 1738142064 694595 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1738152223 976113 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 245 seconds
< 1738152328 317955 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1738152824 51509 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1738153201 345730 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02User:Tommyaweosme/albuquerque hexdump10]]": Copyright violation: not public domain (hexdumping a file doesn't uncopyright it, it's still a derivative of a copyrighted work and thus copyrighted)
> 1738155738 848962 PRIVMSG #esolangs :14[[07Mazerunner14]]4 10 02https://esolangs.org/w/index.php?diff=150991&oldid=150523 5* 03BrainFuckGirl 5* (+3) 10/* Disan Count */ corrected error in code example
> 1738157749 79358 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150992&oldid=150986 5* 03PrySigneToFry 5* (+258) 10
< 1738165289 98001 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 265 seconds
> 1738166807 475342 PRIVMSG #esolangs :14[[07^ RGB8 panel14]]4 10 02https://esolangs.org/w/index.php?diff=150993&oldid=150751 5* 03Unname4798 5* (-86) 10
> 1738170753 73756 PRIVMSG #esolangs :14[[07User:Blashyrkh/A+B-brainfuck14]]4 N10 02https://esolangs.org/w/index.php?oldid=150994 5* 03Blashyrkh 5* (+8513) 10A+B in Brainfuck, 322 bytes long
< 1738170767 941308 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1738171011 41791 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=150995&oldid=150981 5* 03Dmiz 5* (+197) 10
> 1738171618 89558 PRIVMSG #esolangs :14[[07A+B Problem/brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=150996&oldid=126008 5* 03Blashyrkh 5* (+770) 10One more A+B implementation in Brainfuck. Arbitrary non-negative integers, low memory consumption
> 1738172074 696047 PRIVMSG #esolangs :14[[07User:Blashyrkh14]]4 N10 02https://esolangs.org/w/index.php?oldid=150997 5* 03Blashyrkh 5* (+408) 10Links to subpages on the personal page
> 1738172156 253240 PRIVMSG #esolangs :14[[07User:Blashyrkh14]]4 M10 02https://esolangs.org/w/index.php?diff=150998&oldid=150997 5* 03Blashyrkh 5* (+0) 10fix link
> 1738172943 157383 PRIVMSG #esolangs :14[[07User:QuantumV14]]4 N10 02https://esolangs.org/w/index.php?oldid=150999 5* 03QuantumV 5* (+15) 10Created page with "I make esolangs"
< 1738174317 484405 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1738174527 431912 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1738174719 278882 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Read error: Connection reset by peer
< 1738174925 136564 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738180259 12752 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net JOIN #esolangs * :realname
< 1738180273 603742 :craigo!~craigo@user/craigo QUIT :Remote host closed the connection
< 1738182957 432048 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 246 seconds
< 1738185273 675747 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
> 1738187003 110665 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=151000&oldid=150995 5* 03Dmiz 5* (+224) 10Undo revision [[Special:Diff/150620|150620]] by [[Special:Contributions/Dmiz|Dmiz]] ([[User talk:Dmiz|talk]])
> 1738187020 690038 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=151001&oldid=151000 5* 03Dmiz 5* (+1) 10
< 1738187080 644276 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Ping timeout: 240 seconds
< 1738187151 676822 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1738187209 268082 :ajal!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1738187247 920307 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Ping timeout: 252 seconds
< 1738188889 563274 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
> 1738191706 78289 PRIVMSG #esolangs :14[[07Gd auto level14]]4 10 02https://esolangs.org/w/index.php?diff=151002&oldid=138745 5* 03Tommyaweosme 5* (+24) 10
< 1738195747 964349 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1738197972 122611 PRIVMSG #esolangs :14[[07PIKOlang14]]4 M10 02https://esolangs.org/w/index.php?diff=151003&oldid=134150 5* 03Matronator 5* (+31) 10
> 1738198404 737399 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=151004&oldid=150802 5* 03AdjectiveNounNumber 5* (+435) 10
> 1738198969 539968 PRIVMSG #esolangs :14[[07LJAPL14]]4 M10 02https://esolangs.org/w/index.php?diff=151005&oldid=150904 5* 03Calculus is fun 5* (-1087) 10Changed link with compressed version
> 1738199251 620631 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=151006&oldid=151004 5* 03AdjectiveNounNumber 5* (-16) 10
< 1738201396 163623 :ajal!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1738201447 896332 PRIVMSG #esolangs :14[[07PIKOlang14]]4 10 02https://esolangs.org/w/index.php?diff=151007&oldid=151003 5* 03Matronator 5* (+494) 10add note about punctuation and usage in other languages
< 1738204461 665501 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Did folks see this yet? https://github.com/ccz181078/Coq-BB5 BB(5,2) and BB(2,4) champions proven to be optimal.
< 1738204545 548162 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :...Did we already talk about this? I don't remember it, but my notes are already updated for it.
< 1738205645 143557 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Today is Chinese
< 1738205991 963751 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1738206090 380257 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: we've extensively discussed an announcement that prominently linked to that
< 1738206113 272551 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :so a lot of people here have probably discovered it like that, even if we didn't discuss it directly – I know that's how I came across it
> 1738207403 448253 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=151008&oldid=151001 5* 03Dmiz 5* (+288) 10
< 1738209918 392696 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: It's entirely possible that we had an entire multi-hour discussion and I've just forgotten it. Happens a lot.
> 1738210936 365991 PRIVMSG #esolangs :14[[07Gd auto level14]]4 10 02https://esolangs.org/w/index.php?diff=151009&oldid=151002 5* 03PrySigneToFry 5* (+286) 10Used more formal grammar.
< 1738213901 343251 :Lykaina!~lykaina@user/lykaina JOIN #esolangs Lykaina :Lykaina Wolfe
< 1738213913 676238 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :hi
> 1738213973 942875 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151010&oldid=150800 5* 03PrySigneToFry 5* (+1027) 10/* I simply use the page without the User: prefix for redirect to my userpage. */ new section
> 1738214076 800998 PRIVMSG #esolangs :14[[07PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=151011&oldid=142737 5* 03PrySigneToFry 5* (+116) 10Redirected page to [[User:PrySigneToFry]]
< 1738214113 905445 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Hi.
< 1738214130 26259 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :wrote my first befunge program
< 1738214187 386733 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :https://lykaina.sdf.org/esolangs/catline.bef
< 1738214240 727604 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Nice! Very neat symmetry. I don't remember how Befunge works; what does it do?
< 1738214294 976531 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :basically, 2d enhanced brainfuck
< 1738214332 926751 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :oh, you mean my program
< 1738214371 424378 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :a cat program that stops at newline
< 1738214657 426709 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i also wrote an interpreter in python
< 1738214805 948609 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Good times.
< 1738214807 939934 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the 4 i/o commands need work atm
> 1738215206 745367 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02PrySigneToFry10]]": cross-namespace redirect
> 1738215310 898219 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151012&oldid=151010 5* 03Ais523 5* (+734) 10/* I simply use the page without the User: prefix for redirect to my userpage. */ that's a cross-namespace redirect, which is not allowed; links to the earlier discussions about it
< 1738215376 957890 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: that looks like Befunge-93, right?
< 1738215445 721436 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :are you interested in ways to make it smaller/shorter, or do you prefer the way it is? (Most of my use of Befunge has been in golf competitions, so I am used to trying to write it tersely, but of course there's no actual reason to do that)
< 1738217825 650115 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :befunge golfing can be very fun
< 1738217840 586096 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i used to golf a couple of easy project euler tasks
< 1738218212 21790 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :you could probably do some trampoline stuff with the 5s, like #+5-#+5-# and going left and right over it
< 1738218287 548710 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :but it's probably easier to just duplicate and drop instead
< 1738218316 901989 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1738220774 690374 :mtm!~textual@47.202.75.129 QUIT :Read error: Connection reset by peer
< 1738220977 66689 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1738221852 726881 PRIVMSG #esolangs :14[[07Gd auto level14]]4 10 02https://esolangs.org/w/index.php?diff=151013&oldid=151009 5* 0347 5* (+4) 10
> 1738222436 878915 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02GD auto level10]]": doesn't appear to be a different language from the one at [[Gd auto level]]; makng a second page documenting the same language a PoV fork (thus not allowed), you should come to a consensus on how to document it on the original page
< 1738223529 501142 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 JOIN #esolangs * :realname
< 1738223679 934072 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net QUIT :Ping timeout: 252 seconds
> 1738224183 36678 PRIVMSG #esolangs :14[[07A+B Problem/brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=151014&oldid=150996 5* 03Blashyrkh 5* (+1) 10If I understand it correctly, this minor change will remove extra examples (mine as well) from the main A+B page
> 1738224264 439699 PRIVMSG #esolangs :14[[07A+B Problem/brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=151015&oldid=151014 5* 03Blashyrkh 5* (-1) 10Remove extra empty line
< 1738224722 747468 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1738225333 181563 :FreeFull!~freefull@epq236.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 252 seconds
< 1738225447 90192 :FreeFull!~freefull@79.186.197.171.ipv4.supernova.orange.pl JOIN #esolangs FreeFull :FreeFull
> 1738225592 440555 PRIVMSG #esolangs :14[[07A+B Problem/brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=151016&oldid=151015 5* 03Blashyrkh 5* (+0) 10
> 1738225837 453748 PRIVMSG #esolangs :14[[07User:I am islptng/List of the users that is also in conwaylife.com14]]4 10 02https://esolangs.org/w/index.php?diff=151017&oldid=149619 5* 03I am islptng 5* (+11) 10I need contributions to this page!
> 1738228401 401205 PRIVMSG #esolangs :14[[07User:I am islptng/List of the users that is also in conwaylife.com14]]4 10 02https://esolangs.org/w/index.php?diff=151018&oldid=151017 5* 03I am islptng 5* (+53) 10
> 1738230156 14228 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03X-540 5* 10New user account
> 1738230177 339692 PRIVMSG #esolangs :14[[07Gd auto level14]]4 10 02https://esolangs.org/w/index.php?diff=151019&oldid=151013 5* 03PrySigneToFry 5* (+14) 10
> 1738230408 29753 PRIVMSG #esolangs :14[[07User:I am islptng/List of the users that is also in conwaylife.com14]]4 10 02https://esolangs.org/w/index.php?diff=151020&oldid=151018 5* 03PrySigneToFry 5* (+22) 10
> 1738230623 516844 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151021&oldid=151012 5* 03PrySigneToFry 5* (+1129) 10/* I seem to find that I've written a lot of more formal programming languages. */ new section
> 1738230877 134334 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151022&oldid=151021 5* 03Ais523 5* (+562) 10/* I seem to find that I've written a lot of more formal programming languages. */ this wiki is only for esolangs, but most programming languages that can be created quickly by a single person are esolangs
> 1738231714 516871 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=151023&oldid=150817 5* 03X-540 5* (+279) 10/* Introductions */
< 1738231863 615759 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :``` hg cat -r12510 /hackenv/wisdom/password # korvo: we talked about BB(5,2) proven. I hadn't known about BB(2,4) but I'm not paying attention to the busy beaver competitions as much as some other users here.
< 1738231867 295612 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :The password of the month is BB(5) = 47176870
< 1738231962 553461 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :``` hg log -r12510 -T '{date(date,"%Y-%m-%d %H:%M")}' /hackenv/wisdom/password # must have been known by that time
< 1738231965 404085 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :2024-08-01 01:08
< 1738232052 928240 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :ais523: yeah, it's befunge-93
< 1738232324 620141 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i'm writing a befunge-93 interpreter for micropython
< 1738232342 381914 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, I wonder whether the playfield is large enough for that
< 1738232350 783985 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :if it isn't, you could switch to befunge-98 which has more space
< 1738232373 548019 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 QUIT :Quit: Leaving
< 1738232386 282478 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i mean, in micropython
< 1738232404 683324 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i just woke up
< 1738232533 75079 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the language the befunge-93 interpreter is written in is micropython
< 1738232559 678417 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh, that makes more sense
< 1738232603 996124 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :this is the sort of channel where if someone said they were writing a C compiler in BF, I would probably a) expect them to fail but b) expect they were genuinely trying
< 1738232658 715568 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :and, it's a variant of befunge-93 due to ram and lcd limitations
< 1738232683 553213 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :30x38 instead of 80x25
< 1738232735 761650 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :but the code is being written so it can easily run on 80x25 as well
< 1738232873 880705 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the rp2040 only has so much ram
< 1738232944 349679 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :and the display i'm using is a 240x320 model
< 1738232996 478298 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :and i want the grid to appear on the lcd while it is running
< 1738233175 25775 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the ultimate goal is being able to code the befunge-93 variant on the rp2040 using IR input (17-button remote)
> 1738233530 602827 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=151024&oldid=149887 5* 03PrySigneToFry 5* (+983) 10/* */ new section
< 1738233836 259879 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i bought a pico 2w (rp2350 chip) which has twice the ram as the pico w (rp2040 chip) yesterday but it will not arrive until saturday.
< 1738234157 333723 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i have no idea why the rp2040 has 294kb ram, when it's direct competitor, the esp32, has 500kb-ish...seems a little shortsighted
< 1738234321 504019 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :glad they doubled the ram and flash for the rp2350-based Pico 2/Pico 2w (flash on rp2040-based Pico/Pico W is 2MiB)
< 1738234406 245903 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :flash on a commonly-available esp32 model is 4 MiB
< 1738234717 759723 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the rp2350 designers were clearly aware of the esp32s3's capabilities when they designed their chip
> 1738234940 410654 PRIVMSG #esolangs :14[[07Seed14]]4 10 02https://esolangs.org/w/index.php?diff=151025&oldid=120207 5* 03None1 5* (+27) 10/* References */
> 1738235168 840444 PRIVMSG #esolangs :14[[07SeedFuck14]]4 N10 02https://esolangs.org/w/index.php?oldid=151026 5* 03None1 5* (+760) 10Created page with "'''SeedFuck''' is an esolang invented by [[User:None1]], it is [[seed]] but for [[brainfuck]]. Programs are like this: ==Random Generator== SeedFuck uses Python 3.11's random generator, it generates numbers from 0-8 and translates the numbers into brainf
> 1738235224 524450 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=151027&oldid=150871 5* 03None1 5* (+52) 10/* Brainfuck derivatives */
> 1738235244 110127 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=151028&oldid=150282 5* 03None1 5* (+53) 10/* My Esolangs */
> 1738235361 654160 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=151029&oldid=150538 5* 03None1 5* (+99) 10/* Commands */
< 1738236390 943709 :mcfrdy!~mcfrdy@user/mcfrdy QUIT :Quit: quit
< 1738238605 251121 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Lykaina: are you writing the editor itself in befunge? befunge has the p command so it can edit its own playfield so that might work
< 1738238688 67711 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1738238741 288873 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1738239082 565026 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=151030&oldid=150942 5* 03Unname4798 5* (+680) 10
< 1738239644 673836 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I think a lot of RP2040 boards bump up the flash size from the "default" (Pico) 2MB.
< 1738239730 285217 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :(For example I built -- well, half-finished -- a thing on top of the Adafruit Feather RP2040 and it's got 8MB of flash.)
< 1738239891 211708 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :just woke from nightmare-scene of being in a hotel where it was dark and turning on lights to find i triggered the fire suppression system.
< 1738240072 326051 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :The display for that device is one of those 20x4 character text-only LCDs (though there's enough on-board RAM to have 8 custom symbols).
< 1738240081 119263 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Didn't think of putting Befunge on it though.
< 1738240849 187978 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :fizzie: is that for a programmable calculator?
< 1738241173 832596 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :It's for a (pretty pointless) USB peripheral that's a combined temperature/humidity sensor plus a box with a clickable rotary knob + that display, that I can put a menu on and use it to display... stuff. Current plans call it to display, well, the temperature and humidity, but also any alerts from Prometheus monitoring, because I've proven quite adept at ignoring the email alerts.
< 1738241207 459425 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :The thinking is, if I make it so the display backlight is on whenever there's unacknowledged alerts, I'll be more diligent in responding to them.
< 1738241446 575800 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Which may or may not be true. It's currently stalled on getting the box that houses it made. I did the CAD part of it, and there's a laser cutter here at the office, but I'd need to do two separate visits (first to do a test cut with an array of different tolerances, to see what gives a nice fit; and then to do the real thing) and that feels like so much effort.
< 1738241487 565866 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Plus I haven't decided exactly what to make it out of, there's a bunch of clear 3mm acrylic here but I'm not sure if I want it to be transparent or not.
< 1738241787 533561 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Bah, just checked the timestamps, it was like 2023 when I left this, it's been over a year already, that's terrible.
< 1738242897 690879 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1738242898 660977 :APic!apic@apic.name PRIVMSG #esolangs :What! Me worry? ‑ Alfred E. Neumann
> 1738244101 770361 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=151031&oldid=149683 5* 03PrySigneToFry 5* (+592) 10
< 1738244134 875797 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 272 seconds
> 1738244520 987878 PRIVMSG #esolangs :14[[07Talk:SeedFuck14]]4 N10 02https://esolangs.org/w/index.php?oldid=151032 5* 03Blashyrkh 5* (+362) 10Created page with "Few suggestions: * "it generates numbers from 0-8" sounds ambiguously, it's better to say "from 0 to 7 inclusive"; * it's not an interpreter, it's a transpiler from SeedFuck to brainfuck; * k,l=map(int,input().split())
saves one line of python code. Be
< 1738245613 657478 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :b_jonas: the editor is one i made in micropython
> 1738245722 674173 PRIVMSG #esolangs :14[[07Talk:Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=151033&oldid=149285 5* 03Win7HE 5* (+64) 10
> 1738246137 984928 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=151034&oldid=149294 5* 03Win7HE 5* (+6) 10/* (without looping or jumps) Truth Machine */
> 1738246630 378778 PRIVMSG #esolangs :14[[07Talk:SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151035&oldid=151032 5* 03Blashyrkh 5* (+349) 10and one more suggestion
< 1738249348 1383 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1738249791 878573 PRIVMSG #esolangs :14[[07Gd auto level14]]4 10 02https://esolangs.org/w/index.php?diff=151036&oldid=151019 5* 03PrySigneToFry 5* (+22) 10Fixed command for make "Hello, world!" possible to construct
> 1738253875 319820 PRIVMSG #esolangs :14[[07Stackfish14]]4 N10 02https://esolangs.org/w/index.php?oldid=151037 5* 03I am islptng 5* (+175) 10Created page with " i increment TOS d decrement TOS s square TOS o output TOS z push 0 r push a number read from stdin n put TOS to the bottom of stack p...q Same as bf [] but TOS instead"
> 1738254118 659431 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151038&oldid=151037 5* 03I am islptng 5* (+98) 10
< 1738254317 675835 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1738254628 930145 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i have all but one command in my micropython implementation of befunge-93 implemented.
< 1738254660 38619 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the command i am having trouble with is '&'
< 1738254676 272088 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :is that numeric input?
< 1738254689 354236 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :yes
< 1738254696 75797 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :esolangs, what does the & command do in befunge?
> 1738254705 732198 PRIVMSG #esolangs :b_jonas: In Befunge, the `&` command is used for **"addressing"**. It takes the current stack pointer and **references the value at that address**. This allows you to manipulate data stored in memory locations. Think of it like a pointer that points to a specific memory location.
< 1738254765 680668 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :sorry, that's c
< 1738254928 919310 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :numeric input is what i'm saving for last
< 1738255340 634083 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1738255359 648614 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1738255596 178991 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1738255792 216875 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :esolangs: bad, no botsnack for you
> 1738255820 880815 PRIVMSG #esolangs :FireFly: The message "bad, no botsnack for you" is a humorous response from Lambdabot, likely in response to a user trying to use the bot to access botsnack. Botsnack is a feature of the IRC bot, and it's not available to everyone. The bot is designed to be a fun and educational tool for exploring esoteric programming languages.
< 1738256033 838127 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1738256055 650188 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1738258649 738126 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :wow, I almost believed esolangs on that for a moment
< 1738258658 728035 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :AI hallucinations can be really convincing sometimes
< 1738258764 499775 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :@botsnack
< 1738258764 547781 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs ::)
< 1738258909 543688 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :fixed https://lykaina.sdf.org/esolangs/catline.bef
< 1738259588 720574 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :ais523: indeed
> 1738259802 413956 PRIVMSG #esolangs :14[[07SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151039&oldid=151026 5* 03Ractangle 5* (+6) 10decided to make the equivalent shorter
< 1738261237 136006 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1738261244 339367 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
> 1738261321 379481 PRIVMSG #esolangs :14[[07Talk:SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151040&oldid=151035 5* 03Blashyrkh 5* (+279) 10Suggestions never end
< 1738261423 33684 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1738261642 558829 PRIVMSG #esolangs :14[[07Talk:SeedFuck14]]4 M10 02https://esolangs.org/w/index.php?diff=151041&oldid=151040 5* 03Blashyrkh 5* (-3) 10More appropriate headings
> 1738262238 994126 PRIVMSG #esolangs :14[[07SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151042&oldid=151039 5* 03Ractangle 5* (+29) 10
> 1738262269 959193 PRIVMSG #esolangs :14[[07SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151043&oldid=151042 5* 03Ractangle 5* (+14) 10/* Random Generator */
< 1738262997 574885 :Lykaina!~lykaina@user/lykaina QUIT :Remote host closed the connection
< 1738263137 732980 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I'm always tempted to check the logs to see what (if any) pages were used in the construction of those nonsense answers.
< 1738263254 926937 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Looks like it searched for (unsurprisingly) "botsnack", and then passed in the contents of https://esolangs.org/wiki/Lambdabot as context.
< 1738263326 82216 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :(Not that the page says anything about botsnack other than including it in the "list of most commands".)
> 1738264652 845827 PRIVMSG #esolangs :14[[071^14]]4 10 02https://esolangs.org/w/index.php?diff=151044&oldid=147761 5* 03Ractangle 5* (+3) 10/* Syntax */
< 1738265833 909149 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`whatis botsnack
< 1738265838 251843 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :botsnack(1hackeso) - no description \ botsnack(8lambdabot) - no description
< 1738265849 473669 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`botsnakc
< 1738265851 343192 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`botsnack
< 1738265851 427619 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :botsnakc? No such file or directory
< 1738265853 103755 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :>:-D
< 1738265936 11439 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :esolangs: can you write me a unefunge program printing "hello #esolangs"?
> 1738266112 945445 PRIVMSG #esolangs :FireFly: ```unefunge #define AAAA __TIME__ $$$$$$$$"!dlrow ,olleH"zzzzzzz #define AAAB @ __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define AABA > __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define AABB : __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABAA v __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABAB _ __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABBA , $$$$$$$$...
> 1738266112 949197 PRIVMSG #esolangs :__TIME__ $$$$$$$$ __TIME__ #define ABBB ^ $$$$$$$$ __TIME__ $$$$$$$$ __TIME__ AAAA AABA AABB ABAA AAAB ABBB ABBA ABAB AAAB ``` This code defines a series of macros that will be expanded by the preprocessor. The macros are designed to print "hello #esolangs" when run.
< 1738266140 381398 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :I-I didn't ask for an ioccc submission...
< 1738266272 736229 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :hm
< 1738268149 999014 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 260 seconds
< 1738270916 998795 :Lykaina!~lykaina@user/lykaina JOIN #esolangs Lykaina :Lykaina Wolfe
> 1738272004 631699 PRIVMSG #esolangs :14[[07Befunge14]]4 10 02https://esolangs.org/w/index.php?diff=151045&oldid=147548 5* 03BoundedBeans 5* (+53) 10Replace malicious Rc/Funge-98 link with Wayback Machine
> 1738272489 78522 PRIVMSG #esolangs :14[[071^14]]4 10 02https://esolangs.org/w/index.php?diff=151046&oldid=151044 5* 03Ractangle 5* (-17) 10/* Syntax */
< 1738272769 975764 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 260 seconds
< 1738274269 314125 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1738275578 570859 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Excess Flood
< 1738275847 945205 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1738275874 197188 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738276175 162598 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Excess Flood
< 1738276285 171840 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :Quit: bye bye
< 1738276337 971029 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1738276386 632819 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738277636 833759 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :https://lykaina.sdf.org/esolangs/catline.bef
< 1738277642 606364 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :oops
< 1738279978 492654 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :great...my micropython befunge takes up 137600 bytes of ram
< 1738279998 584343 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :*befunge interpreter
< 1738280054 153097 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :and that's without the &
< 1738280083 354392 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :(numeric input)
< 1738280564 737031 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :time to implement garbage collection
< 1738281754 422748 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1738281965 681581 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1738284249 443884 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1738284576 631518 :int-e!~noone@int-e.eu PRIVMSG #esolangs :`? cdop
< 1738284579 779995 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :CDOP is OCPD, except with the letters in the *proper* order.
< 1738287506 242209 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1738287896 939487 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1738290307 254137 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :https://lykaina.sdf.org/esolangs/catline.b93
< 1738290390 546173 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1738290550 964107 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1738292069 400663 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151047&oldid=151022 5* 03I am islptng 5* (-1660) 10I don't want to leave my real name here anymore.
> 1738292134 740242 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=151048&oldid=151031 5* 03PrySigneToFry 5* (+118) 10
> 1738292139 850453 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=151049&oldid=151047 5* 03I am islptng 5* (-86) 10/* Soft redirect */
> 1738292286 953434 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=151050&oldid=150476 5* 03I am islptng 5* (+1) 10
> 1738292321 967334 PRIVMSG #esolangs :14[[07TripletNOR14]]4 10 02https://esolangs.org/w/index.php?diff=151051&oldid=123297 5* 03I am islptng 5* (+1) 10
> 1738292355 585882 PRIVMSG #esolangs :14[[07StackBBQ14]]4 10 02https://esolangs.org/w/index.php?diff=151052&oldid=144161 5* 03I am islptng 5* (+1) 10
> 1738292377 689648 PRIVMSG #esolangs :14[[07Alivehyperfish14]]4 10 02https://esolangs.org/w/index.php?diff=151053&oldid=144452 5* 03I am islptng 5* (+1) 10
> 1738292407 530467 PRIVMSG #esolangs :14[[07JSFlak14]]4 10 02https://esolangs.org/w/index.php?diff=151054&oldid=144966 5* 03I am islptng 5* (+1) 10
> 1738292479 354223 PRIVMSG #esolangs :14[[07Talk:Befunge14]]4 10 02https://esolangs.org/w/index.php?diff=151055&oldid=137748 5* 03PrySigneToFry 5* (+902) 10
> 1738292536 37674 PRIVMSG #esolangs :14[[07User:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=151056&oldid=149472 5* 03PrySigneToFry 5* (+5) 10Wouldn't "The admin" will better?
> 1738292681 222073 PRIVMSG #esolangs :14[[07Gift14]]4 10 02https://esolangs.org/w/index.php?diff=151057&oldid=144126 5* 03PrySigneToFry 5* (+141) 10
> 1738292682 804640 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=151058&oldid=150954 5* 03I am islptng 5* (+588) 10/* Any interests on joining our Esolang Tencent QQ group? */
> 1738292966 19515 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=151059&oldid=151058 5* 03PrySigneToFry 5* (+941) 10
> 1738293564 919008 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=151060&oldid=151059 5* 03I am islptng 5* (+606) 10/* */
> 1738293950 776321 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=151061&oldid=151060 5* 03PrySigneToFry 5* (+878) 10
> 1738295388 387511 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 10 02https://esolangs.org/w/index.php?diff=151062&oldid=149925 5* 03Aadenboy 5* (-3431) 10blanking in preparation of eventual move
> 1738295413 35594 PRIVMSG #esolangs :14[[07User:Aadenboy/Ultimate warsides14]]4 10 02https://esolangs.org/w/index.php?diff=151063&oldid=150218 5* 03Aadenboy 5* (-6081) 10blanking
< 1738295431 840201 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :night all
< 1738295443 330638 :Lykaina!~lykaina@user/lykaina QUIT :Quit: Leaving
> 1738295444 100231 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=151064&oldid=150566 5* 03Aadenboy 5* (-65) 10/* anything else */
< 1738297399 487170 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1738297429 451803 :ais523!~ais523@user/ais523 PRIVMSG #esolangs : FireFly: ```unefunge #define AAAA __TIME__ $$$$$$$$"!dlrow ,olleH"zzzzzzz ← I like the way it has a backwards "Hello, world!", that must be the Unefunge influence on the output
< 1738300169 813360 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1738304495 90003 PRIVMSG #esolangs :14[[07Zyxonia/Common Command List14]]4 N10 02https://esolangs.org/w/index.php?oldid=151065 5* 03PrySigneToFry 5* (+2175) 10Created page with "{{Back|Zyxonia}} Here are more analyzation for every command. = System command control = do SubroutineName Indicates the beginning of a subroutine (or function). end Indicates the end of a subroutine (or function). CLS Clear the screen.
> 1738304546 759197 PRIVMSG #esolangs :14[[07Zyxonia14]]4 10 02https://esolangs.org/w/index.php?diff=151066&oldid=150975 5* 03PrySigneToFry 5* (+60) 10
< 1738305273 277341 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Why is the object identifiers for BLAKE2 only the number of hash bits which is divisible by thirty-two, as far as I can tell? I thought BLAKE2 uses number of hash bits which is divisible by eight?
< 1738306653 907429 :FreeFull!~freefull@79.186.197.171.ipv4.supernova.orange.pl QUIT :
< 1738306670 437221 :FreeFull!~freefull@79.186.197.171.ipv4.supernova.orange.pl JOIN #esolangs FreeFull :FreeFull
> 1738307542 726544 PRIVMSG #esolangs :14[[07Stackfish14]]4 M10 02https://esolangs.org/w/index.php?diff=151067&oldid=151038 5* 03Cycwin 5* (+43) 10
> 1738307594 247036 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151068&oldid=151067 5* 03Cycwin 5* (+2) 10
> 1738308428 767217 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151069&oldid=151068 5* 03I am islptng 5* (+740) 10
> 1738313729 681742 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151070&oldid=151069 5* 03Cycwin 5* (-1) 10
< 1738314752 665085 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1738316010 315810 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151071&oldid=151070 5* 03Cycwin 5* (+53) 10
< 1738319344 33274 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: I don't know what object identifiers you're talking of
< 1738320024 620513 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :are you familiar with how we link to nontrivial brainfuck projects from the wiki? I'm not much into brainfuck so I'm not sure. I want to add https://www.youtube.com/watch?v=bmFmsn6VZSM which is about a large brainfuck program https://github.com/mitxela/bf-tic-tac-toe with some popular introduction to brainfuck.
< 1738320127 766845 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :also the video links to https://www.linusakesson.net/programming/brainfuck/index.php which I somehow wasn't aware of, presumably I just don't click on links that say "Brainfuck"
< 1738320177 498675 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :do I just put these under https://esolangs.org/wiki/Brainfuck#External_resources or is there a better place?
> 1738320846 276772 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=151072&oldid=149332 5* 03B jonas 5* (+286) 10/* External resources */
> 1738320949 293243 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=151073&oldid=150818 5* 03B jonas 5* (+96) 10Infrabuck, a Brainfuck compiler for Win32 by mitxela
> 1738322380 153347 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=151074&oldid=150045 5* 03I am islptng 5* (-19) 10
> 1738322474 750942 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=151075&oldid=151074 5* 03I am islptng 5* (-120) 10
> 1738324278 237557 PRIVMSG #esolangs :14[[07Cav14]]4 M10 02https://esolangs.org/w/index.php?diff=151076&oldid=80555 5* 03Calculus is fun 5* (+0) 10Incorrect homophone fixed
< 1738325060 499491 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1738325145 36699 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1738325925 4517 PRIVMSG #esolangs :14[[07User:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=151077&oldid=147596 5* 03MihaiEso 5* (-7) 10
> 1738326824 815831 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=151078&oldid=150896 5* 03Calculus is fun 5* (+8) 10/* Leaping back */ changed inconsistent plurals
> 1738327153 876 PRIVMSG #esolangs :14[[07Funciton14]]4 10 02https://esolangs.org/w/index.php?diff=151079&oldid=150564 5* 03Timwi 5* (-210) 10Update the example factorial function, which has changed a fair bit
> 1738327470 510621 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=151080&oldid=151078 5* 03Calculus is fun 5* (-44) 10Changed condition example
> 1738328153 671980 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=151081&oldid=151080 5* 03Calculus is fun 5* (+0) 10/* Creating conditions */
> 1738328378 128165 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=151082&oldid=151081 5* 03Calculus is fun 5* (+11) 10minor formatting
< 1738331521 958755 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1738333495 948229 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: you can link any relevant external page from External resources, although if the list gets long it males sense to sort it with subheadings (that doesn't happen for most esolangs though) – there's an exception for the BF page in particular where most implementations got moved to a subpage for length reasons
< 1738333531 188759 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ok
> 1738334291 448538 PRIVMSG #esolangs :14[[07SeedFuck14]]4 10 02https://esolangs.org/w/index.php?diff=151083&oldid=151043 5* 03None1 5* (+5) 10
< 1738334537 939372 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1738335021 130379 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1738335323 47269 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=151084&oldid=150928 5* 03PrySigneToFry 5* (+95) 10/* 0x1F609 */ new section
< 1738335776 677274 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 JOIN #esolangs DOS_User_webchat :[https://web.libera.chat] DOS_User_webchat
< 1738337670 103091 :DOS_User_webchat!~DOS_User_@user/DOS-User-webchat:37962 QUIT :Remote host closed the connection
< 1738343751 209285 :Lykaina!~lykaina@user/lykaina JOIN #esolangs Lykaina :Lykaina Wolfe
< 1738343774 503647 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :is esolangs.org offline?
< 1738343915 499489 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Probably.
< 1738343958 509662 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i got: 504 Gateway Time-out
< 1738344243 657806 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :ais523: esolangs.org is not working
< 1738344298 897689 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Ah, you want something to be done about it.
< 1738344352 311074 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: I am the wrong person to ping for that, you want to ping fizzie
< 1738344363 736636 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I moderate the site, but I don't own it
< 1738344378 610257 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :fizzie: esolangs.org is not working
< 1738344393 147205 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it does appear to be down, though
< 1738344413 601441 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :logs.esolangs.org is still up, that might help narrow down the issues somewhat
< 1738344466 131398 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Hmm.
< 1738344476 763664 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I was just about to head out for groceries.
< 1738344586 101999 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Pursue work-life balance. The server can wait.
< 1738344620 405655 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i need a sample "hello world" in befunge
< 1738344667 306896 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: give me a moment
< 1738344670 161928 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :25*"!dlrow ,olleH">:#,_@ is what my memory suggests as the canonical one.
< 1738344688 663582 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :here: https://tio.run/##S0pNK81LT/3/X0kxJacoP1xBJz8nJ9VDyc5KWSfe4f9/AA
< 1738344708 194722 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Mine's got an extra newline in it, otherwise it's the same.
< 1738344721 743850 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :ah, fizzie's has a newline, I got mine from a codegolf collection so they leave newlines out whenever they can get away with it :-)
< 1738344737 359491 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :https://zem.fi/tmp/cpu.png <- that doesn't look great.
< 1738344759 962264 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I'll see if just restarting nginx or something fixes it, otherwise it'll have to wait until after shopping.
< 1738344968 747708 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :FTR, there's been some pretty aggressive "clearly crawling without a crawler UA" crawling going on for the last couple of weeks again.
< 1738345129 54154 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Or else a number of people are *really* interested in old article versions and diff pages, and also always follow the link to Special:CreateAccount from constantly but don't actually make accounts.
< 1738345137 901447 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Which sounds somewhat unlikely.
< 1738345185 181341 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I wonder whether we could put some sort of invisible trap link on the page that blocks your IP if you visit it, robots.txt'd out and not visible to normal browsers
< 1738345282 309007 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :It might end up with a pretty long blocklist, the rate is roughly 5-10 qps but only one request every 15 minutes or so from any single IP.
< 1738345298 130364 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It can be done wholly with nginx but it's a bit of a pain. First, identify possible crawlers based on high request rate. Second, serve invisible trap links to possible crawlers. Third, put anybody who clicks the trap link into a 24hr slow-loris jail.
< 1738345299 951689 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Which are all regular consumer ISPs.
< 1738345317 120099 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Do *not* block crawlers. It only burns their IPs, which are no longer as expensive as they used to be.
< 1738345343 484598 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :It's not that easy to distinguish these requests from legitimate ones TBH.
< 1738345373 303439 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It can't be done per-request. It requires a context that associates each request with a likelihood of crawling.
< 1738345408 641289 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :And serving invisible trap links can't be done anymore; crawlers use browser heads to prune out links that humans can't see.
< 1738345430 419475 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: these ones might not – they're disregarding robots.txt, which most crawling frameworks wouldn't
< 1738345439 880048 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :...Sorry, I'm in "free advice" mode. I'll fuck off and find breakfast.
< 1738345467 167936 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: robots.txt is for humans, not bots; it can't possibly protect a site.
< 1738345553 977195 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: well, it's for well-behaved bots, which a) gives the well-behaved bots more useful information in most cases where it's used (because it helps them avoid pages that wouldn't be useful for them) and b) makes well-behaved bot behaviour easier to identify, which in turn makes badly-behaved bot behaviour easier to identify
< 1738345613 738656 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :intentionally ignoring robots.txt is weird, that normally a) makes life worse for the bot as it gets lots of irrelevant pages, b) makes life worse for the site owner as they have to handle lots of irrelevant requests, thus c) increases the incentive of the site owner to block the bot, potentially meaning it gets no results at all
< 1738345618 863470 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Well, it's... sluggish, but sort of back up.
< 1738345673 314340 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :there is very little advantage to doing that, so whoever has not programmed their bots to respect it either a) doesn't know it exists, in which case the crawler is probably very primitive, or b) is intentionally ignoring it, in which case there is something weird about the operation that might affect the crawler in other ways
< 1738345701 339753 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :looks like either this is miscoded, or my interpreter got something backwards: 25*"!dlroW ,olleH">:#,_@
< 1738345737 288295 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I've been assuming they're intentionally trying to appear as non-bots, given that the user agents are those of regular browsers, and all the traffic is originating from a big set of (spot-checking a handful) just regular consumer ISPs (so, a botnet?).
< 1738345738 336560 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :is your interpreter filling the stack with infinitely many implicit 0s at the start of the program?
< 1738345759 791442 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :fizzie: botnet is quite possible
< 1738345777 850315 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :have you tried putting some of the ISPs into one of those sites which records known botnets?
< 1738345783 630045 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :err, IPs, not ISPs
< 1738345874 863864 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I tried one, and it says it's not a bot, but it *is* a VPN, with a "84% - Abusive IP" status, whatever that means.
< 1738345879 834658 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :found the problem: my interpreter has the '_' backwards
< 1738345894 93833 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :So I guess that's another option, VPN providers would presumably want to make their connections look "regular" as well.
< 1738345942 742204 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh right, VPN would make a lot of sense for that
< 1738345985 863612 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I may need to do look into something like limiting old page revisions and diffs to logged-in users only.
< 1738345989 985382 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :But now off to the shoppe.
< 1738346166 927468 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :also had '|' backwards
< 1738346185 309504 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: do you know of Mycology?
< 1738346199 686108 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :no
< 1738346205 42871 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :admittedly it might not be usable if your playfield is smaller than usual
< 1738346209 677420 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it is a Befunge interpreter testsuite
< 1738346219 868764 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :mostly aimed at Befunge-98 but it does have a Befunge-93 section
< 1738346252 947987 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :my playfield is 80x25 atm
< 1738346262 951906 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh, that's the standard size I think
< 1738346325 42979 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: I appreciate your perspective. I wasn't spitballing, but distilling serious lessons learned from working at large companies with lots of incoming requests. One important concept is Hyrum's Law, which has one phrasing of "clients can send servers any well-typed message".
< 1738346355 849225 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :robots.txt is a political tool with which to pressure e.g. Google to be better-behaved, sure, but it is fundamentally useless against adverse scrapers.
< 1738346394 959348 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: I have an interesting viewpoint on Hyrum's Law – it's basically "if you change any API endpoint that anyone could potentially be using (even if they aren't supposed to), even in a way that shouldn't theoretically matter, it will probably break something for someone – it's up to you to decide whether you think that breakage is acceptable"
< 1738346440 482987 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but in many cases, the breakage can be acceptable (or sometimes even intentional)
< 1738346703 289893 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: ah, found the link, https://deewiant.iki.fi/projects/mycology/
< 1738346725 708855 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: My viewpoint is that Hyrum is a valued former coworker with a valuable insight. I once spent about a quarter-year of my Google employment performing per-request analysis on *internal* RPCs that were overwhelming an internal service.
< 1738346770 494760 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I am not convinced that these viewpoints contradict each other
< 1738346803 688673 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, of course not.
< 1738346934 510316 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :fixed this: https://lykaina.sdf.org/esolangs/catline.b93
< 1738346987 75307 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :renaming it to echoline.b93 in a few minutes
< 1738347067 561529 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :there: https://lykaina.sdf.org/esolangs/echoline.b93
< 1738347228 70034 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: there is a microcontroller manufacturer named Microchip who attempted (maybe still attempts, I haven't checked on them in a while) to document the entirety of the behaviour of their microcontrollers, including behaviour that might seem useless or invariant-breaking; I think this may have been intended for demoscene-like eking out of the entire power of the chips, but it also works quite well as an attempt to avoid Hyrum's Law
< 1738347278 127618 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(the main thing that had to be left undefined was behaviour in undervoltage situations, but even then the chips had optional undervoltage detection that would turn them off when undervolted and reboot them when they had enough voltage to operate again)
< 1738347342 295486 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: I wonder if they include the radio topology! I'll let you know if I find the paper; there's a great peer-reviewed writeup of learning an FPGA circuit according to its inputs and outputs, and the learned circuits display radio self-interference which appears to be essential to their correctness.
< 1738347343 129402 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I do like the approach of "if you were considering relying on undocumented behaviour, we documented it so you can rely on it safely", although of course that approach generally works only because microcontrollers aren't really updated at all
< 1738347386 607737 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: if that's the paper I'm thinking of, the machine-learning had been set a task that was impossible under normal invariants (distinguishing between two square waves of different frequencies with no other timing source)
< 1738347397 360665 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :There's an entire part of machine learning, "specification gaming", which studies the edge of the specification at its implementation. Closely related to weird machines, as you might guess. I had to learn this stuff at Google just to manage Web traffic.
< 1738347411 430569 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :so it's not surprising that it evolved something invariant-breaking to solve the task
< 1738347446 854439 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I suspect that if the task were possible with normal digital logic, the evolver would have solved it that way
< 1738347492 842874 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(that said, I imagine the researchers were expecting it to evolve a timing source, like the "seven NOT gates connected in a cycle" example that I was taught at university)
< 1738347520 501882 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Only if "normal" also means "simple", "cheap", or some other concrete metric which admits a comparison. Evolution just...doesn't care about "normal", "readable", "debuggable", etc. (I know you know this. But Secunda has to say certain things so that Prima has a path.)
< 1738347530 315418 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Read error: Connection reset by peer
< 1738347707 876745 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: well, in this case I would define normal digital logic as a circuit that damps analog effects, in order to prevent analog variations having any long-term effect on the state of the circuit (i.e. if you change the voltage of a wire at a given point in time by, say, 1V, then after waiting sufficiently many seconds all wires will be within, say, 0.1V of where they would have been without the change) – when designing digital circuits engineers normally
< 1738347709 312943 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :design them like that because it makes them much easier to reason about
< 1738347727 416688 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and thus an approach that amplifies the analog effects rather than damping them is the "abnormal" approach to circuit design
< 1738347743 487459 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738347801 617475 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :intuitively, you would think that evolutionary algorithms might be more likely to find easier-to-reason-about circuits because it would mean that mutations have smaller effects, increasing the chance of converging on nearby solutions rather than diverging; but I don't know whether that's actually the case in practice or not
< 1738347883 340519 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(the other reason why engineers prefer solutions that damp analog effects and are easy to reason about is that they are more likely to be reusable in other contexts, where the analog situation might be different)
< 1738348056 436694 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :my befunge-93 interpreter does I/O over a serial interface. the REPL interface instead outputs a ton of debug data.
< 1738348063 964414 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Excess Flood
< 1738348093 607851 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1738348182 322253 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: The other day I watched a video which credited you with realizing that certain NES games have intra-frame logic which can be provoked with unreasonably fast inputs. The other day I also showed my friends a video with very long clarinets, demonstrating how pitches smoothly become beats at low Hz.
< 1738348222 312020 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: yes, it was me who realised that, although it was other people who made use of that fact to do interesting things like completing SMB3 in less than a second
< 1738348238 692661 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I think that if we try to establish a sense of normality or expectation, we inadvertently set up implicit domains (in Hz, in these cases) which leave us blind to the full capabilities of the machine.
< 1738348257 289860 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it is a fun feeling to reason out the existence of a glitch in a game, without anyoen actually encountering it
< 1738348336 297497 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I used to play drums. Some drums, despite being *played* at low Hz, will *resonate* at high Hz, and thus they sometimes must be tuned. In extreme cases, like kettledrums/timpani, both frequencies are changing simultaneously.
< 1738348372 477937 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think it usually makes engineering sense to not use the full capabilities of the machine, especially if there are any chances the same code might need to be reused on other machines – generally speaking being able to reuse code is an advantage, both for maintainability and for development cost
< 1738348392 761810 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but it can be fun to do the things that don't make engineering sense, sometimes
< 1738348413 96167 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I am disappointed at how few NES games beam-race, for example
< 1738348457 212 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :ever hear of the NES port of Elite?
< 1738348461 31825 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Sure! But it does raise something of a dilemma. Knowing that weird machines exist, we must either say that the code changes behavior from one machine to another (to prevent weirdness) or that the code is invariant over some abstract machine. But in the latter case, we now have weirdness from the embedding of the abstract machine into each particular target, and the embeddings can't have the same (lack of?) weirdness since we assumed that we're por
< 1738348461 158775 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ting.
< 1738348514 528626 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :So if we insist that our code is portable then we doom ourselves to an eternal parade of weird implementations of it.
< 1738348624 928908 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :one project that I am slowly not working on (I would like to work on it, but don't have the mental energy) is a greatest-common-divisor of practical programming languages – the aim being that everything it supports maps either directly or via monomorphisation into a very large range of practical programming languages, even those which have limitations
< 1738348659 158340 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :part of the idea being to improve the compiler's idea of what the program is doing, allowing for better optimisations
< 1738348672 659539 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Or, rephrasing for the initial problem, if we insist that requests to esolangs.org are always adhering to portable standards-compliant HTTP, then we doom ourselves to an eternal parade of weird scrapers who will do everything they can to exploit that portability and compliance.
< 1738348690 963603 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but the main interest to me is to see which language features I can omit and still have a usable language
< 1738348710 587233 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :e.g. how much of an obstacle to the programmer is it if data can't be moved (in the C++/Rust sense) at all?
< 1738348738 328736 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: I am not sure what sense of "insist" you mean there?
< 1738348763 241865 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :is it along the lines of "assume that" or along the lines of "reject if not"?
< 1738348790 893712 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: In the assumptive sense. My entire point is that, when we sit down at the machine, any sort of expectations we set up are going to fundamentally limit our view so that we aren't seeing the machine's full range of behaviors.
< 1738348851 8355 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: ah right – my view was more along the lines of "we can assume that legitimate connections are probably going to be portable standards-compliant HTTP, so noticing the ones that aren't may be a way to discover the illegitimate ones"
< 1738348863 837108 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I first learned this via reading Pirsig, a philosopher from the USA who talked about the way that humans make judgments about reality. He once was employed to document a Fortran implementation, and found that folks had the whole monks-and-elephant experience when working with machines.
< 1738348934 724678 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: Ah, okay, I see. Yeah, I think working at Google ruined me on that; I don't really expect good behavior on port 80 even from well-meaning folks who just want to GET an HTML page. But otherwise I think we're pretty well-aligned.
< 1738349010 529156 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it is basically impossible to run a mailserver without being fully aware of the sort of nonsense that is likely to come from malicious actors, and occasionally well-meaning actors too
< 1738349053 468637 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh meatballs, operating email is awful. Truly the worst task out there. I've outsourced it for decades and refuse to do it. At this point email is more like a cultural institution than a technical standard.
< 1738349065 68957 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :there is a check that some mailservers use, that any email they receive must be from an IP address whose forward and reverse DNS are consistent with each other – but those servers have discovered that it occasionally somehow rejects legitimate emails they want to receive
< 1738349070 166324 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Although I did think that JMAP was pretty cool, and I hear that it's gaining traction.
< 1738349088 405608 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :in my opinion, http nonsense is partly why gemini (not google gemini) exists and gopher still exists.
< 1738349143 965640 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :my mailserver does have a check that the reverse DNS is set to something, and will reject emails from IPs with no reverse DNS at all
< 1738349154 479592 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :somehow this manages to block around 50% of spam by itself
< 1738349180 340975 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :my guess is that spammers often don't have much choice about what IP they're using
< 1738349191 465397 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Lykaina: Yeah, for sure. It's interesting to me to see the differences in design between Gopher, which predated HTTP and was purpose-built to serve university students, vs Gemini's reactionary approach.
< 1738349208 508887 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(that said, it is probably redundant with "known not to be a mailserver" DNSBL checks, although it does save effort in making the check in the first place)
< 1738349264 167930 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :the other surprising thing is just how much trivially blockable spam there is – the spam that even gets as far as the spam filter is a very small fraction of the total
< 1738349273 490255 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it is unclear who those spammers are targeting, if anyone
< 1738349533 821414 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Some of it is just lowest-tier spamming in certain parts of the world where IT culture isn't as developed but email access is common. My personal theory is that DAOs started manifesting in the late 1990s, not the late 2010s, and some spammers are literally Perl scripts running on forgotten compute in a basement with no accounting.
< 1738349633 301471 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think it may just be that the cost-benefit equation falls on the side of "the cost is effectively zero, and the benefit is ???"
< 1738349640 680517 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :cost-benefit to the spammers, that is
< 1738349693 169093 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Youngsters might like looking up the story of Morris' Worm, possibly the first email worm, or the later I Love You Worm, which both were very cheap to execute and relied on "living off the land" (often LOTL) by reusing tools on the infected machines instead of bundling them.
< 1738349770 198489 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It doesn't have to have any benefit. Evolution isn't really "survival of the fittest". It's more like "survival of whatever fits" or "the better it fits, the likelier it is to survive".
< 1738349804 87907 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Niches are merely the current metagames.
< 1738349852 7724 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, I think it's a matter of semantics whether or not the Morris Worm was an email worm, but also think that that's neatly covered by the "possibly"
< 1738349852 644841 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :korvo: i thought evolution was survival of whatever survives to reproduce and reproduces the most
< 1738349904 876321 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Lykaina: Once we're in an autocatalytic environment, yes. Abiogenesis, the part of chemistry that studies how life evolved, turns out to have a fairly rich theory *before* the development of autocatalytic DNA, the so-called "RNA World".
< 1738349931 516380 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :This isn't just hypothesis, BTW; we just found "obelisks", RNA fragments that appear to have some proto-life behaviors, in humans. By accident, mostly, by analyzing existing data.
< 1738349958 847057 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :cool
< 1738349985 332771 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Lykaina: You know how, when we implement genetic algorithms, we have all of those hyperparameters that control rates of reproduction and etc.? There's evolution with fixed hyperparameters, and evolution where the hyperparameters also evolve.
< 1738350086 601331 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :So "survives to reproduce" might actually be "survives longer than some hyperparameter", which might actually be "survives longer than some statistic derived from all existing survivors", which allows for meta.
< 1738350179 685257 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: Huh, that's an interesting quibble. I suppose that we call it a "worm" as a definition rather than a description?
< 1738350300 896487 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: oh, I was quibbling over the "email" part – it attacked sendmail, but IIRC not in a way that involved actually sending email
< 1738350364 129746 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: Oh, that's fair. And is sendmail really even email? Like, I'm not even joking: was what people did before IMAP and POP3 actually email, or a sort of proto-email that looked more like remote-shell?
< 1738350442 2130 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I still think it's interesting, although I could agree that it's not directly making the point as well as I Love You.
< 1738350580 272962 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think that at the time, sending email happened in a way that's recognisable even nowadays, but receiving email didn't (it functioned more like "people are expected to have a shell account directly on the mailserver and read their email like that")
< 1738350778 878566 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :For email, I have my own server only for receiving, but the ISP's server is used for sending, and I had not had a problem with that so far, as far as I can tell. I do not have a matching forward and reverse DNS, and there are other reasons also why it might not match
< 1738351114 467449 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the interpreter crashed while running the 'p' command when running the befunge-93 part of mycology
< 1738351224 550731 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :'p' can be a hard command to get right, so that seems like a plausible sort of error
< 1738351272 37199 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :How can I add comments to GitHub issues, now? They changed something and now it is not working, although I could get the existing comments to be displayed, I could not add a new one. Will the API have to be used for this purpose, now? (I have got the API to work before, at least to create a new repository, so it might still work, but then a separate program must be used for display or adding new comments.)
< 1738351288 107860 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Also, I get a 502 error when accessing esolang wiki, now)
< 1738351525 155206 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :the only thing that mycology said that wasn't good this time is: UNDEF: edge # skips column 80
< 1738351618 113006 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :it continued with another GOOD after
< 1738351630 241305 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Lykaina: UNDEF means that the specification has multiple reasonable interpretations
< 1738351639 510994 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :" Pursue work-life balance." => out of the groceries and esolangs, which one is work?
< 1738351650 510174 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :if you get UNDEF rather than BAD it means that you are following a reasonable interpretation of the specification, but it is not the only reasonable interpretation of the specification
< 1738351675 226175 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :there is no way to get a GOOD in such cases, so don't worry about it as long as there is no BAD
< 1738351683 827548 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i think it works
< 1738351775 638349 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Lykaina: https://rosettacode.org/wiki/Hello_world/Text#Befunge or https://rosettacode.org/wiki/Hello_world/Newbie#Befunge
< 1738351871 720661 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: I've had to make some groceries-or-esolangs decisions semi-recently, I considered the groceries as work
< 1738351889 822925 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :fortunately there is usually enough time for boht
< 1738352046 336553 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :b_jonas: Sysadmin responsibilities are labor, and oftentimes toil as well. It's okay to put off labor sometimes.
< 1738352366 340268 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :well, one of the main reasons to work is to put food on the table – the more difficult part of that is obtaining the money to buy groceries with, but actually buying the groceries is also part of that
< 1738352373 953471 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :my main conclusion is that, in this case, both are work
< 1738353133 643474 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Ah, sure. I was raised with that sort of Biblical hate, and I try not to bring it into communities, particularly communities which aren't moving around any money.
< 1738353667 999438 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :" limiting old page revisions and diffs to logged-in users only." => if you do that, please put an exception for the Befunge page so that if that page is maliciously changed people can still find out how to pass the captcha
< 1738354168 543959 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :korvo: that must be https://www.youtube.com/watch?v=pk_6NrDsiHM
< 1738354308 865376 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :b_jonas: Yep. Guess it's going around.
< 1738354463 967687 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :re: the very low clarinet note, I've done something similar myself using an oscillator that could be set to very low frequencies and a speaker, although it's less fun than doing it with an actual wind instrument
< 1738355773 264948 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :It's still pegged at 100% CPU, and most requests are timing out at 60s. I wonder if there's something more going on than just the number of diff requests.
< 1738355865 707900 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I see a lot of references to the Esolang:Introduce_yourself and Esolang:Sandbox pages, which are pretty gigantic (well, at least for some old versions) and probably the most expensive single requests there are.
< 1738355944 903025 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Maybe I'll try quickly blocking URLs that involve diffing two versions of those two pages, since it seems unlikely anyone would _really_ need to do that particular thing.
< 1738356265 103476 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I think I have diffed Introduce Yourself, but it's true that I don't really need it, I could download the source codes and diff locally
< 1738356506 878375 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :It's also possible there's something more wrong going on, since there isn't *that* much traffic that it should generally be quite this overloaded.
< 1738356571 388060 :ais523!~ais523@user/ais523 PRIVMSG #esolangs : Maybe I'll try quickly blocking URLs that involve diffing two versions of those two pages, since it seems unlikely anyone would _really_ need to do that particular thing. ← those are actually some of the pages I diff most often, precisely because they're so large – it's helpful to get an idea of just what changed, when someone edits them
< 1738356599 342277 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but I can find a workaround if needed
< 1738356639 331938 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Well, if the block seems to help, I can try to fine-tune it to be for logged-out users only.
> 1738356918 633068 PRIVMSG #esolangs :14[[07How dare you fuck the brain14]]4 10 02https://esolangs.org/w/index.php?diff=151085&oldid=150769 5* 03Ractangle 5* (+240) 10/* computational class */
< 1738357071 898578 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :if the wiki becomes healthy enough to actually perform admin actions, I could try revision-hiding the old revisions to prevent them being diffed
> 1738357083 743903 PRIVMSG #esolangs :14[[07Stackfish14]]4 M10 02https://esolangs.org/w/index.php?diff=151086&oldid=151071 5* 03Calculus is fun 5* (+2027) 10/* Interpreter */
< 1738357086 262367 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :(Though I'm not 100% sure how to manage that. I don't think nginx is aware if someone's logged-in or not, unless it's implied by cookies in an easy-to-parse way. MediaWiki itself is, of course, but I don't know if it has settings on that level, I suspect it's all grouped under the "read" right.)
< 1738357122 747063 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Judging from those edits, it may be at least somewhat working again.
> 1738357159 572048 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=151087&oldid=150898 5* 03Ractangle 5* (-25) 10/* Stuff to continue */ I ain't putting this into the list of done esolangs nor will i try to make the syntax better
> 1738357174 312995 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 245 revisions on page [[02Esolang:Sandbox10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357200 589460 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Sandbox10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
< 1738357207 659039 :chomwitt!~alex@2a02:587:7a26:9800:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
< 1738357214 170603 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I hope that doesn't spark the sandbox wars again. :/
< 1738357275 222357 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I was worried about that too, but I'm adding a clear reason for hiding
> 1738357299 483136 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 249 revisions on page [[02Esolang:Sandbox10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357305 59295 PRIVMSG #esolangs :14[[07Stackfish14]]4 M10 02https://esolangs.org/w/index.php?diff=151088&oldid=151086 5* 03Calculus is fun 5* (+2) 10Fixed A+B example
> 1738357360 533878 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Sandbox10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357381 104321 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 192 revisions on page [[02Esolang:Sandbox10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
< 1738357436 304248 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :FTR, my quick little fix was to start returning a 503 for anything where the CGI params match /diff=.*title=Esolang:(?:Sandbox|Introduce_yourself)/ so if you happen to run across that, an almost-trivial probable workaround will be to just reorder the `title=` parameter to come before the `diff=` one in the URL.
> 1738357442 963124 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 241 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357456 21550 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357472 64898 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357485 678566 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357500 190029 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357522 541071 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357536 470618 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357550 186904 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357560 132118 PRIVMSG #esolangs :14[[07Stackfish14]]4 10 02https://esolangs.org/w/index.php?diff=151089&oldid=151088 5* 03Ractangle 5* (-161) 10/* Interpreter */ minified the python interpreter
> 1738357564 563976 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357581 785877 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357597 765534 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 250 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
> 1738357634 766852 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 revision10 02 5* 03Ais523 5* 10Ais523 changed visibility of 76 revisions on page [[02Esolang:Introduce yourself10]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
< 1738357677 548357 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :the quick fix might not be needed after all those revision hides – MediaWiki will reject an attempt to diff if either revision is hidden
< 1738357712 968283 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but it'll probably be a faster way to reject the requests
< 1738357745 617807 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :that said, the hides also cause the diff buttons to be unlinked, so this may cause the crawler to stop even attempting the requests
< 1738357811 214754 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :I'll comment it out and see if it breaks again.
> 1738357883 925774 PRIVMSG #esolangs :14[[07Esolang talk:Community portal14]]4 10 02https://esolangs.org/w/index.php?diff=151090&oldid=145305 5* 03Ais523 5* (+433) 10/* 429 Too Many Requests */ an update
< 1738357885 418040 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Yep, now the URL I was using for testing returns: "You cannot view this diff because one of the revisions has been deleted."
> 1738357984 171999 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=151091&oldid=151087 5* 03Ractangle 5* (+24) 10/* Yayimhere/4kOWO */
< 1738358037 368508 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :fizzie: while logged out, I suppose? (you're an admin, I think admins can diff even through the sort of revision hide I used)
< 1738358218 509776 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Yeah, I was just curl'ing one of the URLs in the logs.
> 1738358340 343878 PRIVMSG #esolangs :14[[07User:Blashyrkh/A+B-brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=151092&oldid=150994 5* 03Blashyrkh 5* (-352) 10Shortened by 6 bytes (316 bytes in stripped form)
> 1738358354 723368 PRIVMSG #esolangs :14[[07User:Blashyrkh14]]4 10 02https://esolangs.org/w/index.php?diff=151093&oldid=150998 5* 03Blashyrkh 5* (+0) 10
> 1738358448 602930 PRIVMSG #esolangs :14[[07A+B Problem/brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=151094&oldid=151016 5* 03Blashyrkh 5* (-6) 10/* Arbitrary integers with reasonably low memory consumption (by User:Blashyrkh) */ Shortened by 6 bytes
> 1738359080 896139 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=151095&oldid=151091 5* 03Ractangle 5* (-15) 10/* Stuff to continue */
> 1738359156 522893 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=151096&oldid=150900 5* 03Ractangle 5* (+57) 10/* Esolangs */
< 1738359303 861572 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :fizzie: if the crawlers switch to a different page, you can either hide the history yourself, or let me know so that I can do it
> 1738359323 647037 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=151097&oldid=150258 5* 03Ractangle 5* (-61) 10/* Hello, world! */ Who needs paragraphs
> 1738359415 475265 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Ractangle 5* 10moved [[02BrainofGolf10]] to [[Blainbuk]]
> 1738359455 162405 PRIVMSG #esolangs :14[[07Blainbuk14]]4 10 02https://esolangs.org/w/index.php?diff=151100&oldid=151098 5* 03Ractangle 5* (-15) 10
> 1738359483 879394 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=151101&oldid=151096 5* 03Ractangle 5* (-3) 10/* Esolangs */
> 1738359765 49327 PRIVMSG #esolangs :14[[07Blainbuk14]]4 10 02https://esolangs.org/w/index.php?diff=151102&oldid=151100 5* 03Ractangle 5* (-237) 10/* Commands */
> 1738359786 764621 PRIVMSG #esolangs :14[[07Blainbuk14]]4 10 02https://esolangs.org/w/index.php?diff=151103&oldid=151102 5* 03Ractangle 5* (-2) 10/* Hello, world! */
> 1738359801 406446 PRIVMSG #esolangs :14[[07User:Lykaina14]]4 10 02https://esolangs.org/w/index.php?diff=151104&oldid=107658 5* 03Lykaina 5* (+41) 10
> 1738359935 804390 PRIVMSG #esolangs :14[[07Fungeball14]]4 10 02https://esolangs.org/w/index.php?diff=151105&oldid=107660 5* 03Lykaina 5* (+62) 10
> 1738360850 584906 PRIVMSG #esolangs :14[[07Stackfish14]]4 M10 02https://esolangs.org/w/index.php?diff=151106&oldid=151089 5* 03Calculus is fun 5* (+130) 10Added hello world
< 1738362781 554780 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i think my befunge-93 interpreter now works
< 1738362817 275930 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i mean, the CPython version
< 1738363206 612599 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :ACTION makes hot pockets for everyone to celebrate...
< 1738363530 450617 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ooh, what are they filled with?
< 1738363600 480880 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :trefunge instructions I guess
< 1738363621 680982 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :cheese pizza
< 1738363688 265115 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :good. but mix in a few trefunge arrows and trampolines too
< 1738363945 554129 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :ACTION considers changing the name of the program file to 'v'.
< 1738364056 666264 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :that way, a befunge file can self-execute if it starts with: #!v
< 1738365039 303149 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :i wonder if that would actually work
< 1738366027 408268 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Lykaina: you could give it a longer name that starts with v at least
> 1738366090 159611 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (H-M)14]]4 M10 02https://esolangs.org/w/index.php?diff=151107&oldid=150770 5* 03Calculus is fun 5* (+47) 10/* MoreMathRPN */
< 1738366221 97713 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :(or of course you could use a befunge variant that skips the first line)
> 1738366354 214453 PRIVMSG #esolangs :14[[07Factorial14]]4 M10 02https://esolangs.org/w/index.php?diff=151108&oldid=150575 5* 03Calculus is fun 5* (+108) 10/* MoreMathRPN*/
< 1738366816 12273 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think there might even be "Befunge interpreter whose name starts with 'v'" on the list of ideas
< 1738366819 391483 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :at least, I know I've seen that before
> 1738366932 996454 PRIVMSG #esolangs :14[[07Factorial14]]4 M10 02https://esolangs.org/w/index.php?diff=151109&oldid=151108 5* 03Calculus is fun 5* (+47) 10/* FALSE */
> 1738366955 729335 PRIVMSG #esolangs :14[[07Factorial14]]4 M10 02https://esolangs.org/w/index.php?diff=151110&oldid=151109 5* 03Calculus is fun 5* (+2) 10/* FALSE */
> 1738366970 456485 PRIVMSG #esolangs :14[[07Factorial14]]4 M10 02https://esolangs.org/w/index.php?diff=151111&oldid=151110 5* 03Calculus is fun 5* (+2) 10/* MoreMathRPN */
< 1738367103 297448 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :didn't work
< 1738367138 443105 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :if only / was a mirror instruction that could turn your instruction pointer up you could just use that
< 1738367457 949605 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :>~:,25*-#v_@
< 1738367458 236920 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :^ <
< 1738367721 309205 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :how do i put that on one line?
< 1738367946 701140 :Lykaina!~lykaina@user/lykaina PRIVMSG #esolangs :does unefunge even have loops?