< 1735689608 982556 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :HNY UK, Ireland, Portugal, Iceland > 1735689610 877598 PRIVMSG #esolangs :14[[072025!14]]4 N10 02https://esolangs.org/w/index.php?oldid=149135 5* 03Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff 5* (+497) 10Created page with "'''2025!''' is an esolang made by [[User:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]]. It only has one command, ''number, which time travels to January 1st of the year ''numbe > 1735689639 99785 PRIVMSG #esolangs :14[[07User:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff14]]4 10 02https://esolangs.org/w/index.php?diff=149136&oldid=148958 5* 03Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff 5* (+36) 10 < 1735689818 331720 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds < 1735689913 804 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1735691117 152712 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :Was going to watch the London fireworks from the office terrace this year, but due to high winds they kept it closed. < 1735691138 349085 :fizzie!irc@selene.zem.fi PRIVMSG #esolangs :So watched it through a very reflective glass instead. < 1735691423 773552 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1735691949 509127 :Sgeo!~Sgeo@user/sgeo PRIVMSG #esolangs :I wonder if anyone's written games for a hypothetical I/O extended Fractran. Thinking about it because I think (but not sure) that Fractran might be easy to implement in WorldsPlayer > 1735692504 550951 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149137&oldid=149111 5* 03Waffelz 5* (+79) 10 < 1735694431 58057 :bongino!~bongino@user/bongino QUIT :Ping timeout: 265 seconds > 1735695731 425529 PRIVMSG #esolangs :14[[07Talk:Deadfish14]]4 10 02https://esolangs.org/w/index.php?diff=149138&oldid=147386 5* 03Bogdan192848 5* (+2555) 10 > 1735695829 405813 PRIVMSG #esolangs :14[[07Talk:Deadfish14]]4 M10 02https://esolangs.org/w/index.php?diff=149139&oldid=149138 5* 03Bogdan192848 5* (+13) 10 < 1735696036 75161 :bongino!~bongino@user/bongino JOIN #esolangs bongino :bongino > 1735696300 63937 PRIVMSG #esolangs :14[[07Talk:Deadfish14]]4 M10 02https://esolangs.org/w/index.php?diff=149140&oldid=149139 5* 03Bogdan192848 5* (+182) 10 > 1735696947 31601 PRIVMSG #esolangs :14[[07Talk:Deadfish14]]4 M10 02https://esolangs.org/w/index.php?diff=149141&oldid=149140 5* 03Bogdan192848 5* (+80) 10 < 1735697675 116451 :__monty__!~toonn@user/toonn QUIT :Quit: leaving > 1735700148 565173 PRIVMSG #esolangs :14[[07User:Jan jelo/TC proof to partial recursive function14]]4 10 02https://esolangs.org/w/index.php?diff=149142&oldid=148414 5* 03Jan jelo 5* (-8) 10/* proof */ < 1735700582 478471 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement > 1735702200 139173 PRIVMSG #esolangs :14[[07User:Jan jelo/TC proof to partial recursive function14]]4 10 02https://esolangs.org/w/index.php?diff=149143&oldid=149142 5* 03Jan jelo 5* (+76) 10/* proof */ > 1735702369 277179 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149144&oldid=149067 5* 03PrySigneToFry 5* (+175) 10/* */ new section > 1735702392 782424 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149145&oldid=149144 5* 03PrySigneToFry 5* (+835) 10/* */ < 1735702450 45658 :bongino!~bongino@user/bongino NICK :bongino_ < 1735702478 370376 :bongino_!~bongino@user/bongino NICK :bongino > 1735702545 156014 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149146&oldid=146882 5* 03PrySigneToFry 5* (-32) 10 < 1735702604 105888 :bongino_!~bongino@user/bongino JOIN #esolangs bongino :bongino > 1735702682 71897 PRIVMSG #esolangs :14[[07202414]]4 10 02https://esolangs.org/w/index.php?diff=149147&oldid=126789 5* 03PrySigneToFry 5* (-190) 10 < 1735705084 444918 :bongino!~bongino@user/bongino QUIT :Quit: Lost terminal < 1735705088 995012 :bongino_!~bongino@user/bongino QUIT :Remote host closed the connection < 1735707606 149556 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Happy New Year US east coast! < 1735708740 183387 :wryl!sid553797@user/meow/Wryl PRIVMSG #esolangs :Happy new year! < 1735712397 951855 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :another piece of impressive hardware reverse engineering that confirms earlier results of black-box reverse engineering, by Ken Shirriff on the Pentium FDIV bug => https://www.righto.com/2024/12/this-die-photo-of-pentium-shows.html < 1735715936 904149 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Fascinating read, thanks. < 1735716029 33696 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) < 1735724678 613720 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1735724752 920449 PRIVMSG #esolangs :14[[07202414]]4 10 02https://esolangs.org/w/index.php?diff=149148&oldid=149147 5* 03Ractangle 5* (+190) 10LIAR > 1735724819 162157 PRIVMSG #esolangs :14[[07Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149149&oldid=149132 5* 03Ractangle 5* (-78) 10/* See also */ > 1735724841 392729 PRIVMSG #esolangs :14[[07Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149150&oldid=149149 5* 03Ractangle 5* (+64) 10/* External resources */ > 1735725200 816452 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149151&oldid=149146 5* 03Ractangle 5* (+15) 10/* Implementations */ < 1735726622 272933 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1735727758 924583 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1735728299 197640 PRIVMSG #esolangs :14[[07Alan's dead fish14]]4 M10 02https://esolangs.org/w/index.php?diff=149152&oldid=144080 5* 03Bogdan192848 5* (+1) 10 < 1735728456 765117 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1735729269 221853 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1735729694 826256 PRIVMSG #esolangs :14[[076 bytes of useless element14]]4 10 02https://esolangs.org/w/index.php?diff=149153&oldid=147682 5* 0347 5* (+60) 10 < 1735730402 665188 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1735730546 468012 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown > 1735731216 451377 PRIVMSG #esolangs :14[[07Not14]]4 10 02https://esolangs.org/w/index.php?diff=149154&oldid=145295 5* 0347 5* (+3) 10/* the whole thing */ > 1735731370 450892 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149155&oldid=117621 5* 03Kaveh Yousefi 5* (+440) 10Rectified two examples and supplemented a page category tag. > 1735731437 244241 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149156&oldid=149155 5* 03Kaveh Yousefi 5* (+187) 10Added a hyperlink to my implementation of the Do-if programming language on GitHub and supplemented the Implemented category tag. > 1735731439 588206 PRIVMSG #esolangs :14[[07Not14]]4 10 02https://esolangs.org/w/index.php?diff=149157&oldid=149154 5* 0347 5* (+286) 10/* Implementation */ > 1735731568 25296 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149158&oldid=149156 5* 03Kaveh Yousefi 5* (+389) 10Supplemented a looping counter example program. > 1735731738 603475 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149159&oldid=149158 5* 03Kaveh Yousefi 5* (+1420) 10Supplemented a Syntax section comprehending an Extended Backus-Naur Form (EBNF) description of the language. > 1735731947 813978 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 032Paule 5* 10New user account > 1735732005 458347 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149160&oldid=149137 5* 032Paule 5* (+7) 10/* Introductions */ > 1735732102 412348 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149161&oldid=149160 5* 032Paule 5* (+93) 10/* Introductions */ > 1735732253 686304 PRIVMSG #esolangs :14[[07Deadfish/Implementations (M-Z)14]]4 10 02https://esolangs.org/w/index.php?diff=149162&oldid=146286 5* 032Paule 5* (+824) 10 > 1735732276 230702 PRIVMSG #esolangs :14[[07Deadfish/Implementations (M-Z)14]]4 10 02https://esolangs.org/w/index.php?diff=149163&oldid=149162 5* 032Paule 5* (-2) 10/* [Odin] */ > 1735732401 419095 PRIVMSG #esolangs :14[[07Deadfish/Implementations (M-Z)14]]4 10 02https://esolangs.org/w/index.php?diff=149164&oldid=149163 5* 032Paule 5* (+4) 10/* Odin */ > 1735732456 589618 PRIVMSG #esolangs :14[[07Deadfish/Implementations (M-Z)14]]4 10 02https://esolangs.org/w/index.php?diff=149165&oldid=149164 5* 032Paule 5* (+10) 10/* Odin */ > 1735732674 119819 PRIVMSG #esolangs :14[[07HQ9~14]]4 10 02https://esolangs.org/w/index.php?diff=149166&oldid=132957 5* 03LuminanceMartlet 5* (-1) 10 < 1735732972 69115 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds < 1735733197 258348 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1735738869 590789 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1735739692 176508 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149167&oldid=149159 5* 03Kaveh Yousefi 5* (+1811) 10Introduced a section furnishing a treatise on the instructions. > 1735739744 802007 PRIVMSG #esolangs :14[[07Do-if14]]4 10 02https://esolangs.org/w/index.php?diff=149168&oldid=149167 5* 03Kaveh Yousefi 5* (+203) 10Accommodated a truth-machine example. > 1735741588 558713 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149169&oldid=128522 5* 03Jan jelo 5* (+170) 10/* Examples */ < 1735741917 185097 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :fizzie: well, now you can test if the state television of Hungary archives are geoip-limited by trying to download the Wiener Philharmoniker Neujahrskonzert within about a week while it stays up. radio version at "https://hangtar-cdn.connectmedia.hu/20250101111459/20250101135724/mr3.mp3" , television version at < 1735741922 421152 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :"https://c401-node62-cdn.connectmedia.hu/4511/055d554bf7c713028b764c6db84ffd93/67754ce6/2025/01/01/2025-000007-M0001-01/media_w206153334_b3000000_0.ts" but keep incrementing the number after the last underscore in %d format up to something like 1200 (I haven't downloaded all of it yet) < 1735741941 389605 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :get them while they're hot, they usually disappear from the internet quickly < 1735742738 451091 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname < 1735744080 59483 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1735744626 788965 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1735744640 706741 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit < 1735744679 511276 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1735746206 757495 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149170&oldid=149169 5* 03Jan jelo 5* (+170) 10/* Examples */ > 1735746358 743012 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149171&oldid=149170 5* 03Jan jelo 5* (+2) 10/* Fibonacci */ > 1735747155 326666 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=149172&oldid=148946 5* 03TheCanon2 5* (+78) 10updated < 1735748152 432206 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname > 1735748680 570073 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149173&oldid=149171 5* 03Jan jelo 5* (+203) 10/* Examples */ > 1735748786 259019 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149174&oldid=149173 5* 03Jan jelo 5* (+17) 10/* Examples */ > 1735748826 785749 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149175&oldid=149174 5* 03Jan jelo 5* (+17) 10/* Examples */ > 1735749495 716548 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=149176&oldid=149175 5* 03PkmnQ 5* (+9) 10/* Fibonacci */ < 1735751262 448201 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 246 seconds > 1735753002 313726 PRIVMSG #esolangs :14[[07Talk:Deadfish14]]4 M10 02https://esolangs.org/w/index.php?diff=149177&oldid=149141 5* 03Bogdan192848 5* (-2052) 10 > 1735753945 63360 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149178&oldid=149176 5* 03Jan jelo 5* (+355) 10/* Examples */ > 1735754806 97063 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149179&oldid=148194 5* 03Jan jelo 5* (+154) 10 > 1735754872 58683 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149180&oldid=149179 5* 03Jan jelo 5* (+14) 10/* Intepreters */ < 1735756134 941765 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1735756158 385045 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 244 seconds < 1735756219 499269 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life > 1735756821 372228 PRIVMSG #esolangs :14[[07User:Shamrocky14]]4 10 02https://esolangs.org/w/index.php?diff=149181&oldid=127080 5* 03Shamrocky 5* (+102) 10/* SOULSBORNE games */ > 1735756930 556403 PRIVMSG #esolangs :14[[07User:Shamrocky14]]4 M10 02https://esolangs.org/w/index.php?diff=149182&oldid=149181 5* 03Shamrocky 5* (+45) 10/* World of Goo */ > 1735758182 278154 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149183&oldid=149161 5* 03Dmiz 5* (+229) 10 > 1735758225 618805 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 N10 02https://esolangs.org/w/index.php?oldid=149184 5* 03Dmiz 5* (+569) 10Created page with "Numeric is a an esolang based in Ascii and lisp syntax in Snap! {| class="wikitable" |+ Important Commands are: |- ! Ascii !! Equivalent |- | 40 || ( |- | 41 || ) |- | 34 || " |- | 95 || _ |} === Hello World: === 40 40 115 97 121 32 34 72 101 108 108 111 32 87 111 1 > 1735758242 908838 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 10 02https://esolangs.org/w/index.php?diff=149185&oldid=149184 5* 03Dmiz 5* (-410) 10 < 1735758757 449972 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1735759431 420429 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 10 02https://esolangs.org/w/index.php?diff=149186&oldid=149185 5* 03Dmiz 5* (+612) 10 > 1735759806 654529 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 10 02https://esolangs.org/w/index.php?diff=149187&oldid=149186 5* 03Dmiz 5* (-454) 10 < 1735759988 625728 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1735760126 327678 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt > 1735760519 890139 PRIVMSG #esolangs :14[[07Numeric14]]4 N10 02https://esolangs.org/w/index.php?oldid=149188 5* 03Dmiz 5* (+712) 10Created page with "Numeric is a an esolang based in Ascii and lisp syntax in Snap! {| class="wikitable" |+ Important Commands |- ! Ascii !! Equivalent |- | 32 || space |- | 34 || " |- | 40 || ( |- | 41 || ) |- | 95 || _ |} === Hello World!: === 40 40 115 97 121 32 34 72 101 108 108 111 3 < 1735762586 966082 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname < 1735763798 444203 :Festive!A_D@libera/staff/dragon NICK :gAy_Dragon < 1735764151 828525 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1735765239 221259 :roper!~rpr@91.126.186.102 QUIT :Quit: [22:00] < 1735765797 889090 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving > 1735765957 230886 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149189&oldid=149188 5* 03Dmiz 5* (+29) 10 > 1735765983 354850 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149190&oldid=149189 5* 03Dmiz 5* (+0) 10 < 1735766155 87311 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net JOIN #esolangs * :realname < 1735766230 372271 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1735766298 432679 :craigo!~craigo@user/craigo QUIT :Ping timeout: 246 seconds > 1735766734 148633 PRIVMSG #esolangs :14[[07Do-if14]]4 M10 02https://esolangs.org/w/index.php?diff=149191&oldid=149168 5* 03Kaveh Yousefi 5* (+0) 10Amended an orthographic mistake. < 1735768208 765986 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net QUIT :Quit: Leaving > 1735768983 360367 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149192&oldid=149190 5* 03Dmiz 5* (+1076) 10 > 1735769411 951692 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149193&oldid=149192 5* 03Dmiz 5* (-458) 10 > 1735769474 681979 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149194&oldid=149193 5* 03Dmiz 5* (+10) 10 > 1735770221 385911 PRIVMSG #esolangs :14[[07Fuckbrian14]]4 N10 02https://esolangs.org/w/index.php?oldid=149195 5* 03Tommyaweosme 5* (+116) 10Created page with "[[Fuckbrian]] is [[brianfuck]] but only the extra commands == turing completeness == 0 [[categories:joke languages]]" > 1735770646 412674 PRIVMSG #esolangs :14[[07Fuckbrian14]]4 10 02https://esolangs.org/w/index.php?diff=149196&oldid=149195 5* 03Tommyaweosme 5* (-2) 10 < 1735772066 44210 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1735773984 806314 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1735774430 140169 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving > 1735775094 264509 PRIVMSG #esolangs :14[[07SLet/Implementation14]]4 10 02https://esolangs.org/w/index.php?diff=149197&oldid=147152 5* 03ZCX islptng 5* (-10801) 10Replaced content with "{{back|SLet}} NOT YET!" > 1735775123 447948 PRIVMSG #esolangs :14[[07SLet/algo14]]4 10 02https://esolangs.org/w/index.php?diff=149198&oldid=146920 5* 03ZCX islptng 5* (-2397) 10Blanked the page > 1735775443 214477 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149199&oldid=147212 5* 03ZCX islptng 5* (-2619) 10 > 1735776078 21011 PRIVMSG #esolangs :14[[07S*bleq14]]4 10 02https://esolangs.org/w/index.php?diff=149200&oldid=141369 5* 03ZCX islptng 5* (+148) 10 < 1735776215 414962 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds < 1735776336 479618 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User < 1735780937 220217 :fria!uid151648@id-151648.ilkley.irccloud.com JOIN #esolangs fria :fria < 1735780965 853191 :fria!uid151648@id-151648.ilkley.irccloud.com QUIT :Client Quit > 1735781445 557177 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149201&oldid=149199 5* 03ZCX islptng 5* (+0) 10 > 1735781509 199299 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149202&oldid=149201 5* 03ZCX islptng 5* (-1) 10 < 1735783827 540212 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement < 1735786076 538946 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Ugh, Metamath is such a simple language that it's not worthwhile to write an abstract reusable parser; it takes only like 10-20 lines of Python to parse, starting with .split(), for concrete tasks. < 1735786102 956670 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :This isn't bad, but I'm into Yet Another 40-Line Script instead of building abstractions, which feels like an unsustainable direction. < 1735787138 148152 :ais523!~ais523@user/ais523 QUIT :Quit: quit > 1735787594 569367 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Hajunsheng 5* 10New user account < 1735791724 979076 :Sgeo!~Sgeo@user/sgeo QUIT :Ping timeout: 260 seconds < 1735791769 380776 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1735795885 989883 PRIVMSG #esolangs :14[[07Closuretalk14]]4 M10 02https://esolangs.org/w/index.php?diff=149203&oldid=148999 5* 03Rdococ 5* (-413) 10/* Conclusion */ < 1735802660 689569 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1735806222 527331 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1735810937 229935 PRIVMSG #esolangs :14[[07Sep14]]4 N10 02https://esolangs.org/w/index.php?oldid=149204 5* 03ZCX islptng 5* (+303) 10Created page with "Sep is an esolang created by islptng. ==Commands==
 >a   a = input  1735810952 941960 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149205&oldid=149204 5* 03ZCX islptng 5* (+0) 10fix
< 1735811062 830287 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735811072 323469 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149206&oldid=149205 5* 03ZCX islptng 5* (+57) 10
> 1735811659 636594 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149207&oldid=149206 5* 03ZCX islptng 5* (+257) 10
> 1735811710 467574 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149208&oldid=149207 5* 03ZCX islptng 5* (+88) 10
< 1735812325 554227 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735812948 271934 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1735815254 985131 :zenmov!~zenmov@user/zenmov JOIN #esolangs zenmov :zenmov
> 1735816176 909312 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149209&oldid=149145 5* 03None1 5* (+325) 10/*  */
< 1735816818 522700 :Lymia!lymia@ayame.servers.aura.moe QUIT :Ping timeout: 276 seconds
< 1735816856 447821 :Lymia!lymia@ayame.servers.aura.moe JOIN #esolangs Lymia :Lymia Aluysia
< 1735817345 588979 :shachaf!~shachaf@user/shachaf PRIVMSG #esolangs :This number format seems appropriate for this channe: https://adamscherlis.github.io/blog/iterlog-coding/
< 1735817362 219830 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735819072 37805 :int-e!~noone@int-e.eu PRIVMSG #esolangs :a floating point Levenshtein-like coding?
< 1735819436 481979 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735819544 618282 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735819747 76002 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735820066 69326 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735820783 768856 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149210&oldid=149178 5* 03Jan jelo 5* (+182) 10/* Examples */
> 1735821281 122797 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149211&oldid=149210 5* 03Jan jelo 5* (+185) 10/* Examples */
> 1735822131 97240 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149212&oldid=149211 5* 03Jan jelo 5* (+11) 10/* Examples */
> 1735822292 749708 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149213&oldid=146880 5* 03Jan jelo 5* (+191) 10/* Examples */
< 1735822902 424286 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1735823124 358979 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735823559 439070 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149214&oldid=149213 5* 0347 5* (+70) 10/* Python */
> 1735823753 618558 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=149215&oldid=149214 5* 0347 5* (-1) 10/* Python */
< 1735824359 466487 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1735824374 271931 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
< 1735824703 747739 :roper!~rpr@91.126.186.102 QUIT :Quit: volta
< 1735825682 584263 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`learn password The password of the month is not from a jedi.
< 1735825689 666057 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :Relearned 'password': password The password of the month is not from a jedi.
< 1735825941 278948 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :shachaf: yes that does seem appropriate here
> 1735826073 677529 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Calculus is fun 5*  10New user account
> 1735826566 301646 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149216&oldid=149183 5* 03Calculus is fun 5* (+186) 10
> 1735826605 673110 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5*  10moved [[02Pycone10]] to [[Track!]]
> 1735826606 77950 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149219&oldid=149216 5* 03Calculus is fun 5* (+106) 10
> 1735826653 962557 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149220&oldid=149217 5* 0347 5* (-237) 10
< 1735827021 967866 :zenmov!~zenmov@user/zenmov QUIT :Ping timeout: 252 seconds
< 1735827100 612884 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735827129 991405 :zenmov!~zenmov@user/zenmov JOIN #esolangs zenmov :zenmov
< 1735829041 96768 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1735830019 779753 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1735831036 801851 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Calculus is fun 5*  10uploaded "[[02File:MoreMathLogo.png10]]"
< 1735831233 988128 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735832304 974886 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1735832466 829734 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1735835034 40659 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735837088 442559 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 N10 02https://esolangs.org/w/index.php?oldid=149222 5* 03Calculus is fun 5* (+3180) 10Intro, Logo, partially done with commands.
> 1735837911 556696 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149223&oldid=149222 5* 03Calculus is fun 5* (+482) 10Added Category tags at bottom
< 1735838647 53749 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735838973 981404 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735840273 950991 :^[!~user@user//x-8473491 QUIT :Ping timeout: 245 seconds
< 1735840386 541322 :^[!~user@user//x-8473491 JOIN #esolangs ^[ :user
> 1735842046 342063 PRIVMSG #esolangs :14[[07InfuckBra14]]4 N10 02https://esolangs.org/w/index.php?oldid=149224 5* 03Tommyaweosme 5* (+484) 10Created page with "{{lowercase}}infuckBra is [[brainfuck]] but its on a torus, so at the end, the code will go back to the start again with the same cell confirgurations == extra commands ==  % - skip next command if this is not first time through == conceptualizing == the script "+
< 1735842563 145026 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1735842565 148393 :zenmov!~zenmov@user/zenmov QUIT :Ping timeout: 252 seconds
< 1735842643 919291 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 264 seconds
< 1735842644 976365 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1735842875 809474 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735843230 964261 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149225 5* 03Jan jelo 5* (+1610) 10Created page with "This python program compiles minsky machine program into Muriel program.(Using state 0 means halt, and the program starts from state 1.) 
 program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' def r(s):     return (s.replace("\\","\\\
> 1735843511 106874 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149226&oldid=149225 5* 03Jan jelo 5* (+1137) 10
> 1735843574 276430 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149227&oldid=149226 5* 03Jan jelo 5* (+0) 10
> 1735843863 939417 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149228&oldid=149212 5* 03Jan jelo 5* (+140) 10/* Computational class */
> 1735843889 991224 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149229&oldid=149227 5* 03Jan jelo 5* (+0) 10
> 1735844203 90562 PRIVMSG #esolangs :14[[07Deadman14]]4 N10 02https://esolangs.org/w/index.php?oldid=149230 5* 03Win7HE 5* (+1128) 10Created page with "'''Deadman''' is created by [[Win7HE]], that contains new stuff like , , , and input, and is a joke language.  == Commands ==   is i,  is d,  is s,  is o,  multiplies by 2,  changes the code pointer position to the accumulator,  sets the accumulator to nothing,  sets the
> 1735844229 775816 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149231&oldid=149230 5* 03Win7HE 5* (+5) 10
> 1735844252 941502 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149232&oldid=149229 5* 03Jan jelo 5* (+21) 10
> 1735844309 19829 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149233&oldid=149231 5* 03Win7HE 5* (+9) 10
> 1735844332 790145 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149234&oldid=149233 5* 03Win7HE 5* (+2) 10/* Hello world program */
> 1735844363 132877 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149235&oldid=149234 5* 03Win7HE 5* (+13) 10/* (without looping with jumps) Truth Machine */
> 1735844421 966926 PRIVMSG #esolangs :14[[07Deadfish14]]4 10 02https://esolangs.org/w/index.php?diff=149236&oldid=148298 5* 03Win7HE 5* (+121) 10
> 1735844433 374431 PRIVMSG #esolangs :14[[07Talk:Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149237&oldid=116445 5* 03Jan jelo 5* (+232) 10
> 1735844473 361184 PRIVMSG #esolangs :14[[07Deadfish14]]4 10 02https://esolangs.org/w/index.php?diff=149238&oldid=149236 5* 03Win7HE 5* (+51) 10/* Variants of deadfish */
< 1735844848 191318 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735845955 577666 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149239&oldid=149223 5* 03Calculus is fun 5* (+1373) 10Finished command list
< 1735846446 158932 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735846555 335040 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735846771 928159 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735846861 107254 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149240&oldid=149239 5* 03Calculus is fun 5* (+362) 10/* Creating conditions */
> 1735847140 481513 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149241&oldid=149240 5* 03Calculus is fun 5* (+22) 10/* Creating conditions */
> 1735847210 723590 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149242&oldid=149241 5* 03Calculus is fun 5* (+56) 10/* Standard operations */
< 1735847564 844280 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735848125 233145 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149243&oldid=149242 5* 03Calculus is fun 5* (+512) 10Added examples
< 1735848134 750730 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735848284 563159 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1735850799 374939 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=149244&oldid=78537 5* 03Jan jelo 5* (+200) 10/* Programming quirk? */
< 1735851343 953689 :roper!~rpr@91.126.186.102 QUIT :Quit: zzz
< 1735853300 114785 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735853769 943234 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149245&oldid=149243 5* 0347 5* (-20) 10/* Implementations */
> 1735853858 257859 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149246&oldid=149245 5* 0347 5* (-239) 10/* Implementations */
> 1735853948 412592 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149247&oldid=149246 5* 0347 5* (-33) 10/* Implementations */
> 1735853973 980254 PRIVMSG #esolangs :14[[07Brain14]]4 10 02https://esolangs.org/w/index.php?diff=149248&oldid=127206 5* 0347 5* (-19) 10/* Categories */
> 1735854002 246257 PRIVMSG #esolangs :14[[07F'juhv iK'tlhUng14]]4 10 02https://esolangs.org/w/index.php?diff=149249&oldid=141956 5* 0347 5* (-19) 10/* Categories */
> 1735854031 424128 PRIVMSG #esolangs :14[[07Scrambled14]]4 10 02https://esolangs.org/w/index.php?diff=149250&oldid=127137 5* 0347 5* (-19) 10/* Categories */
> 1735854050 557523 PRIVMSG #esolangs :14[[07TlhIngan14]]4 10 02https://esolangs.org/w/index.php?diff=149251&oldid=124792 5* 0347 5* (-19) 10/* Valid identifier */
> 1735854051 420269 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149252&oldid=133750 5* 03.k 5* (+117) 10
> 1735854063 887498 PRIVMSG #esolangs :14[[07TREE(3)14]]4 10 02https://esolangs.org/w/index.php?diff=149253&oldid=126294 5* 0347 5* (-19) 10/* Categories */
> 1735854109 523006 PRIVMSG #esolangs :14[[07Esme14]]4 10 02https://esolangs.org/w/index.php?diff=149254&oldid=94111 5* 0347 5* (-22) 10/* Implementations */
> 1735854122 832646 PRIVMSG #esolangs :14[[07FURscript14]]4 10 02https://esolangs.org/w/index.php?diff=149255&oldid=99217 5* 0347 5* (-22) 10/* Compilers */
> 1735854139 468944 PRIVMSG #esolangs :14[[07Snack14]]4 10 02https://esolangs.org/w/index.php?diff=149256&oldid=102375 5* 0347 5* (-22) 10/* Another simple interpreter */
> 1735854278 79534 PRIVMSG #esolangs :14[[07BittyLang14]]4 10 02https://esolangs.org/w/index.php?diff=149257&oldid=143746 5* 0347 5* (-1) 10/* Interpreter in Python */
> 1735857528 520544 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149258&oldid=149252 5* 03.k 5* (+41) 10
> 1735857597 538919 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149259&oldid=149258 5* 03.k 5* (-41) 10Undo revision [[Special:Diff/149258|149258]] by [[Special:Contributions/.k|.k]] ([[User talk:.k|talk]])
< 1735857994 219619 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1735858040 316049 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735858206 123100 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735858713 573114 PRIVMSG #esolangs :14[[07Kiwiscript14]]4 10 02https://esolangs.org/w/index.php?diff=149260&oldid=135542 5* 03Dmiz 5* (+146) 10
> 1735858748 88620 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149261&oldid=149194 5* 03Dmiz 5* (+147) 10
< 1735858749 792858 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735858956 324908 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149262&oldid=149114 5* 03Dmiz 5* (+14) 10numeric
> 1735859514 395817 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149263&oldid=129117 5* 03Dmiz 5* (+13) 10
> 1735859560 53157 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149264&oldid=149263 5* 03Dmiz 5* (-13) 10
< 1735859654 891764 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735859721 891500 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149265&oldid=149264 5* 03Dmiz 5* (+31) 10
> 1735859754 308469 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149266&oldid=149265 5* 03Dmiz 5* (+23) 10
> 1735859763 245343 PRIVMSG #esolangs :14[[07Category:202514]]4 10 02https://esolangs.org/w/index.php?diff=149267&oldid=149266 5* 03Dmiz 5* (-54) 10
< 1735859865 858402 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
> 1735859868 858149 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149268&oldid=149261 5* 03Dmiz 5* (+14) 10
< 1735859880 99843 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1735859884 923358 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149269&oldid=149268 5* 03Dmiz 5* (-14) 10
> 1735859911 235890 PRIVMSG #esolangs :14[[07Talk:Numeric14]]4 N10 02https://esolangs.org/w/index.php?oldid=149270 5* 03Dmiz 5* (+17) 10Created page with "[[Category:2025]]"
> 1735859940 180796 PRIVMSG #esolangs :14[[07Talk:Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149271&oldid=149270 5* 03Dmiz 5* (-17) 10Blanked the page
> 1735859964 450471 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149272&oldid=149269 5* 03Dmiz 5* (+15) 10
> 1735859984 682464 PRIVMSG #esolangs :14[[07Numeric14]]4 10 02https://esolangs.org/w/index.php?diff=149273&oldid=149272 5* 03Dmiz 5* (+4) 10
< 1735860040 746497 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1735860622 788218 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735862554 490579 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1735862735 477241 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1735863012 599960 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149274&oldid=145213 5* 03Kloodi 5* (-2) 10/* Truth Machine */
< 1735863868 34582 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
> 1735865067 690129 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149275&oldid=149262 5* 03Calculus is fun 5* (+18) 10Added MoreMathRPN
> 1735865847 223015 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149276&oldid=149247 5* 03Calculus is fun 5* (+335) 10Added matrix example
< 1735868077 178317 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Ping timeout: 252 seconds
< 1735868352 341060 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1735869260 415552 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149277&oldid=149276 5* 03Calculus is fun 5* (+648) 10Fractran example
< 1735869608 877984 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1735869840 678635 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149278&oldid=149277 5* 03Calculus is fun 5* (+0) 10/* Fibonnaci */
> 1735869897 621262 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149279&oldid=149278 5* 03Calculus is fun 5* (+0) 10/* Fractran interpreter */
< 1735870726 825727 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :
> 1735872030 81474 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149280&oldid=149279 5* 03Calculus is fun 5* (+7) 10replaced ascii arrows with unicode arrows
> 1735877053 828932 PRIVMSG #esolangs :14[[07Sep14]]4 10 02https://esolangs.org/w/index.php?diff=149281&oldid=149208 5* 03ZCX islptng 5* (+2) 10
< 1735892159 971587 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735892889 22709 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735893260 389465 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149282&oldid=149235 5* 03Win7HE 5* (+95) 10
> 1735893533 985071 PRIVMSG #esolangs :14[[07Kiwiscript14]]4 10 02https://esolangs.org/w/index.php?diff=149283&oldid=149260 5* 03Ractangle 5* (-1) 10
> 1735893610 119502 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149284&oldid=148721 5* 03Win7HE 5* (+210) 10
> 1735893868 662609 PRIVMSG #esolangs :14[[07Talk:Deadman14]]4 N10 02https://esolangs.org/w/index.php?oldid=149285 5* 03Win7HE 5* (+20) 10Created page with "hi - [[User:Win7HE]]"
> 1735893911 721250 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149286&oldid=149284 5* 03Win7HE 5* (+31) 10/* Deadman (technically deadfish 2.1) */
> 1735893959 2253 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149287&oldid=149282 5* 03Win7HE 5* (+36) 10
> 1735894016 893598 PRIVMSG #esolangs :14[[07Talk:Deadfish/Constants14]]4 N10 02https://esolangs.org/w/index.php?oldid=149288 5* 03Win7HE 5* (+23) 10Created page with "hello - [[User:Win7HE]]"
> 1735894398 601499 PRIVMSG #esolangs :14[[07Talk:Deadfish with gotos and input14]]4 10 02https://esolangs.org/w/index.php?diff=149289&oldid=148254 5* 03Win7HE 5* (-98) 10
> 1735894419 362893 PRIVMSG #esolangs :14[[07Talk:Deadfish with gotos and input14]]4 10 02https://esolangs.org/w/index.php?diff=149290&oldid=149289 5* 03Win7HE 5* (+18) 10
> 1735894570 386519 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149291&oldid=149287 5* 03Win7HE 5* (+53) 10/* Example Programs */
> 1735894642 978095 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149292&oldid=149291 5* 03Win7HE 5* (+54) 10
> 1735895640 613527 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149293&oldid=149292 5* 03Win7HE 5* (-1) 10/* (without looping with jumps) Truth Machine */
> 1735899902 607713 PRIVMSG #esolangs :14[[07Deadman14]]4 10 02https://esolangs.org/w/index.php?diff=149294&oldid=149293 5* 03Win7HE 5* (+34) 10
> 1735900341 390997 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149295&oldid=147638 5* 03Win7HE 5* (+23) 10
> 1735900365 845468 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149296&oldid=149295 5* 03Win7HE 5* (+5) 10
> 1735900397 53175 PRIVMSG #esolangs :14[[07Scratch14]]4 10 02https://esolangs.org/w/index.php?diff=149297&oldid=149296 5* 03Win7HE 5* (-4) 10
< 1735901466 428860 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735905830 478733 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735905925 176115 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1735908109 868440 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1735908698 378434 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149298&oldid=149151 5* 03PrySigneToFry 5* (+82) 10
> 1735908949 439602 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149299&oldid=148899 5* 03PrySigneToFry 5* (+123) 10
> 1735909471 30951 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149300&oldid=149299 5* 03PrySigneToFry 5* (+448) 10
> 1735909512 841344 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149301 5* 03Jan jelo 5* (+2452) 10Created page with "This python program compiles Minsky machine program into  program.(Using state 0 means halt,and the program starts from state 1.) 
 program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' s=lambda x,y:f'/{x}\\/{y}\\' g=lambda x:f'/{x}\\' loop
> 1735909775 62963 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149302&oldid=149274 5* 03Kloodi 5* (+17) 10
> 1735909780 28682 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149303&oldid=149302 5* 03Jan jelo 5* (+176) 10
> 1735911628 908494 PRIVMSG #esolangs :14[[07Esy14]]4 N10 02https://esolangs.org/w/index.php?oldid=149304 5* 03Win7HE 5* (+7) 10Created page with "[[Eso]]"
> 1735911655 871881 PRIVMSG #esolangs :14[[07Esy14]]4 10 02https://esolangs.org/w/index.php?diff=149305&oldid=149304 5* 03Win7HE 5* (+5) 10
> 1735911691 732934 PRIVMSG #esolangs :14[[07Esy14]]4 10 02https://esolangs.org/w/index.php?diff=149306&oldid=149305 5* 03Win7HE 5* (+5) 10Redirected page to [[Eso]]
> 1735911949 693422 PRIVMSG #esolangs :14[[07User:ZCX islptng/My rate to the user I know14]]4 10 02https://esolangs.org/w/index.php?diff=149307&oldid=148683 5* 03ZCX islptng 5* (+32) 10
< 1735912164 92321 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1735912711 330466 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :so today, I did an OS upgrade but it went wrong, and while recovering I had to configure a network interface manually
< 1735912745 292656 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :ifconfig to bring it up, dhcpcd to get an IP address, but when trying to set up DNS, things went wrong in a somewhat eso way
< 1735912783 384478 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I was trying to use systemd's resolvectl to set a DNS server, but when I ran resolvectl, the setting generally only lasted a second or so, sometimes less
< 1735912793 722396 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and would go back to having no DNS server almost immediately
< 1735912828 5184 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :eventually I fixed it by writing a small script that ran resolvectl every 0.1 seconds in a loop, which held the DNS settings stable for long enough to actually download the packages I needed to complete the update
< 1735912867 815683 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmmm. So would dhcp give you wrong DNS servers or is there a third mechanism involved somewhere?
< 1735912886 315877 :int-e!~noone@int-e.eu PRIVMSG #esolangs :But yeah, that sounds like a fun workaround.
< 1735912908 824632 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :there were no DNS servers being given at all
< 1735912951 504206 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(also this is the first time I've used wired Internet in probably over a decade – trying to figure out how to do it wirelessly would have been even harder)
< 1735912982 215469 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I made a fresh system image for my raspberry over New Year's so there was some network configuration in that too. Nothing adverserial though unless you count the fact that as far as I can see, isc-dhcpd is no longer there, and udhcpd has its own set of quirks.
< 1735913010 878867 :int-e!~noone@int-e.eu PRIVMSG #esolangs :s/serial/sarial/
< 1735913061 483607 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1735913095 779089 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ouch
< 1735913118 937899 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I don't understand how network configuration with dhcp works at all on linux these days
< 1735913140 376992 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :it all seems opaque magic
< 1735913158 590014 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :well whatever opaque magic normally does it wasn't installed at the time
< 1735913187 689843 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :AFAICT, apt got a fraction of the way through the upgrade and then gave up, but most of what it did in the fraction that it completed was uninstalling things
< 1735913239 707154 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I expected udhcpd to default to class-based routing so 192.168.0.1 would come with a /24 netmask... well it gave out a 255.0.0.0 instead. Which happens to work for this setup but I still fixed it. ;-)
< 1735913262 414257 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :as long as you don't need to access any other addresses in 192/8 :-)
< 1735913275 780151 :int-e!~noone@int-e.eu PRIVMSG #esolangs :exactly
< 1735913281 363829 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(what even is there, is it just regular addresses outside 192.168/16?)
< 1735913322 879458 :int-e!~noone@int-e.eu PRIVMSG #esolangs :it would probably even work for that... because raspberry (= router) side the netmasks were correct and 192.168.0.1 is my default gateway.
< 1735913391 788094 :int-e!~noone@int-e.eu PRIVMSG #esolangs :ah
< 1735913440 608850 :int-e!~noone@int-e.eu PRIVMSG #esolangs :It would try to send directly instead of via 192.168.0.1. Still the same link though, and the router would see the packet. So it's murky territory.
< 1735913498 262372 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :this is the second time recently that I heard of an interrupted OS upgrade going bad
< 1735913501 848340 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I still think it would work because of the same link thing.
< 1735913580 289177 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(But would break the moment I'd add a switch.)
< 1735913641 531443 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: it's happened before to me but never quite this badly
< 1735913658 236990 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think last time I still had working networking so I was able to recover before rebooting
< 1735913665 608273 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh, no. The computer *should* try ARP to find the MAC address and that would fail, right?
< 1735913819 362144 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :in such a case, can you boot from a standalone installer disk and use that to access the package database of the existing system and update the OS that way, without depending on most of what's installed in it?
< 1735913865 832053 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :b_jonas: that was my plan B
< 1735913901 50263 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but it would take a while to find a standalone installer, I think I have an old one *somewhere* around here but it would take ages to find, and it is hard to make a new one without networking
< 1735914036 791606 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I see
< 1735914054 221983 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :I do have one of those disks around, though I should probably burn a more recent one
< 1735914099 323491 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :you can use USB sticks rather than CDs
< 1735914105 460130 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I have to do it like that because my laptop doesn't have a CD drive
< 1735914129 330790 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :CDs will give you compatibility to older computers but that usually isn't important unless you're trying to give new life to a computer that's otherwise obsolete
< 1735914130 884027 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :also if I have a bootloader intact and the filesystem isn't horribly corrupted and I have internet (three big ifs) then I can boot the netboot installer from hard disk (I've done that before) since that is bootable as only a kernel and a small initrd, two files 
< 1735914153 928699 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :and I have done the same with a bootloader from a CD but the two files on hard disk too
< 1735914170 454601 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I had intact bootloader, non-corrupted root filesystem but the others weren't mounting, and most of the networking-related packages weren't installed
< 1735914215 206184 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(I fixed the non-mounting filesystems problem by installing udev, which fortunately was in the package cache at the time – the installer pre-loads the package cache with packages it thinks it will need, it made a good decision with that one)
< 1735914602 995441 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmm, which distribution is that?
< 1735914723 592193 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :Ubuntu
< 1735914983 36740 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Okay. So /maybe/ Debian is fine :)
< 1735915191 603954 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :the reason why it gave up was also strange, something went wrong configuring emacs
< 1735915209 517626 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :emacs is unlikely to be essential to the upgrade, so you'd expect the installer to just temporarily deconfigure it during the upgrade
< 1735915218 745153 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :or, well, treat it as half-deconfigured
< 1735915257 571861 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :that's what a purely apt+dpkg-based upgrade would do, but apparently Ubuntu was doing something different
< 1735915300 952535 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :yeah, emacs shouldn't be load-bearing during an upgrade
< 1735915448 722781 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :apt in general was struggling with the half-configured state, I ended up manually uninstalling emacs and everything that depends on it with dpkg
< 1735915457 571903 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :to remove the inconsistency
< 1735915462 252236 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(I reinstalled it afterwards)
< 1735915840 56407 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :Quit: bye bye
< 1735915886 168752 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1735916066 788530 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1735916138 764005 PRIVMSG #esolangs :14[[07User:Tommyaweosme/sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149308&oldid=131101 5* 03Tommyaweosme 5* (+47) 10
< 1735917370 492814 :fowl!~fowl@user/fowl QUIT :Read error: Connection reset by peer
< 1735917408 64364 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
> 1735918598 686607 PRIVMSG #esolangs :14[[07Talk:Python But WORST!!14]]4 N10 02https://esolangs.org/w/index.php?oldid=149309 5* 03Tommyaweosme 5* (+345) 10Created page with "little-known fact: chromeos exists, what does it do on my computer? ~~~~"
< 1735919824 858737 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735921671 619201 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149310&oldid=149298 5* 0347 5* (+56) 10/* Example */
> 1735921785 731356 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149311&oldid=149310 5* 0347 5* (-9) 10/* Example */
> 1735921802 829281 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149312&oldid=149311 5* 0347 5* (+1) 10/* Example */
< 1735921945 531020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1735922146 982825 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149313&oldid=148840 5* 0347 5* (+81) 10/* Hello, world! */
> 1735922155 801348 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149314&oldid=149313 5* 0347 5* (+2) 10/* Implementations */
< 1735923943 596918 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735923959 921828 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1735924099 930696 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
< 1735924460 487174 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
< 1735925384 605669 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735928847 843260 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735929043 496786 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1735929077 121182 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds
< 1735929219 779411 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1735931094 532802 PRIVMSG #esolangs :14[[07Underload/a interpreter in Uiua14]]4 N10 02https://esolangs.org/w/index.php?oldid=149315 5* 03Jan jelo 5* (+986) 10Created page with "This is a [[Underload]] interpreter in Uiua written by [[User:Jan jelo]] 
 C      ::{} State  C0{"aa""b""c"} I      0 S      1 P      2 # * (Join) J  C I::2:0:1..S.:1P. # a (A) A  C I::1:$"(_)"0.S.:1P. # ~ (Flip) F  C I:{}1:0.:2.S.:1P. # : (D
> 1735931164 945437 PRIVMSG #esolangs :14[[07Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149316&oldid=149150 5* 03Jan jelo 5* (+58) 10/* External resources */
> 1735931251 498916 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149317&oldid=149180 5* 03Jan jelo 5* (+37) 10/* Intepreters */
> 1735931555 134861 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Uiua14]]4 N10 02https://esolangs.org/w/index.php?oldid=149318 5* 03Jan jelo 5* (+1471) 10Created page with "This is a [[Brainfuck]] interpreter in Uiua written by [[User:Jan jelo]]. 
 P  (   0@+ | 1@- | 2@< | 3@> | 4@[ | 5@] | 6@. | 7@, | 8 ) Init  {   "\0" "\0"   0 } Lt   0 Rt   1 Pc   2 Pg   3 Op   :Pg:Pc. Cur  Lt Th   (P
< 1735931820 589589 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1735931914 562266 PRIVMSG #esolangs :14[[07Underload/a interpreter in python14]]4 10 02https://esolangs.org/w/index.php?diff=149319&oldid=149133 5* 03Jan jelo 5* (+22) 10
< 1735931915 101627 :roper!~rpr@91.126.186.102 QUIT :Read error: Connection reset by peer
> 1735932022 536765 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149320&oldid=149317 5* 03Jan jelo 5* (+44) 10/* Intepreters */
> 1735932244 433646 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149321&oldid=149104 5* 03Jan jelo 5* (+63) 10/* Python interpreters */
< 1735932258 230302 :roper!~rpr@91.126.186.102 JOIN #esolangs roper :alt
> 1735932306 789789 PRIVMSG #esolangs :14[[07Brainfuck14]]4 M10 02https://esolangs.org/w/index.php?diff=149322&oldid=149321 5* 03Jan jelo 5* (+1) 10/* Python interpreters */
> 1735932547 98560 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149323&oldid=149322 5* 03Jan jelo 5* (+41) 10/* Python interpreters */
> 1735933528 564822 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 N10 02https://esolangs.org/w/index.php?oldid=149324 5* 03Jan jelo 5* (+2386) 10Created page with "This is a [[Brainfuck]] interpreter in Haskell written by [[User:Jan jelo]]. 
 import Data.Char (chr,ord) main = run (filter(\x->any(==x)"+-<>.,[]")pgrm) 0 (Tape(Stack[])(Stack[])) 0 0 pgrm="++++++++++[>+++++++>+++
> 1735933579 21102 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149325&oldid=149320 5* 03Jan jelo 5* (+47) 10/* Intepreters */
> 1735933829 249959 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149326&oldid=149323 5* 03Jan jelo 5* (+77) 10/* Haskell interpreters */
< 1735934153 658780 :roper!~rpr@91.126.186.102 QUIT :Quit: prezzz
> 1735934444 781941 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149327&oldid=149324 5* 03Jan jelo 5* (+44) 10
> 1735934551 572355 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=149328&oldid=149087 5* 03Corbin 5* (+37) 10I suppose that it's only obvious that this is easy mode...
> 1735934590 998959 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149329&oldid=149327 5* 03Jan jelo 5* (-49) 10
> 1735934922 531275 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 N10 02https://esolangs.org/w/index.php?oldid=149330 5* 03Corbin 5* (+2030) 10...if there's also a hard mode available.
> 1735934995 143939 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149331&oldid=148835 5* 0347 5* (+0) 10/* Stuff to continue */
> 1735935703 25613 PRIVMSG #esolangs :14[[07Brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149332&oldid=149326 5* 03Jan jelo 5* (-78) 10/* Notable implementations */
> 1735935939 892744 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=149333&oldid=145135 5* 03Jan jelo 5* (+141) 10/* Normal implementations */
> 1735935987 22110 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149334&oldid=149314 5* 03Ractangle 5* (-10) 10/* Syntax */
> 1735936042 448115 PRIVMSG #esolangs :14[[07Brainfuck implementations14]]4 10 02https://esolangs.org/w/index.php?diff=149335&oldid=149333 5* 03Jan jelo 5* (+0) 10/* Normal implementations */
> 1735936098 371366 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=149336&oldid=149334 5* 03Ractangle 5* (+66) 10/* Implementations */
> 1735936133 864968 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149337&oldid=148839 5* 03Ractangle 5* (-1) 10/* Esolangs */
> 1735937612 403005 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149338&oldid=148170 5* 03Ractangle 5* (-16) 10/* Truth-machine */
> 1735937662 413486 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149339&oldid=149338 5* 03Ractangle 5* (+12) 10/* Truth-machine */
> 1735937714 219047 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149340&oldid=149339 5* 03Ractangle 5* (+0) 101*
> 1735937797 701231 PRIVMSG #esolangs :14[[07G Sharp14]]4 10 02https://esolangs.org/w/index.php?diff=149341&oldid=149340 5* 03Ractangle 5* (-7) 10/* Truth-machine */
> 1735938126 380350 PRIVMSG #esolangs :14[[07User:Aadenboy/Template:Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149342 5* 03Aadenboy 5* (+134) 10Created page with "{{#{{{1|}}}:{{{2|}}}|{{{3|}}}|{{{4|}}}|{{{5|}}}}}{{User:Aadenboy/Template:Sandbox|ifeq|a|b|c|d}}"
> 1735938131 626281 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149343&oldid=149220 5* 03Ractangle 5* (+20) 10
> 1735938147 948768 PRIVMSG #esolangs :14[[07Track!14]]4 10 02https://esolangs.org/w/index.php?diff=149344&oldid=149343 5* 03Ractangle 5* (+0) 10
> 1735938211 497078 PRIVMSG #esolangs :14[[072025!14]]4 10 02https://esolangs.org/w/index.php?diff=149345&oldid=149135 5* 03Ractangle 5* (+2) 10
< 1735938323 713019 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1735939863 93718 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1735941116 976444 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Taking a break from Lojban ontology today to show the youngsters how to Pyline properly. I have hacked up what I think is my smallest, slowest BF interp yet: https://gist.github.com/MostAwesomeDude/d0559414ace589c0536b219d2e086db7
< 1735941137 311916 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I'm about halfway through converting this to Pyline Classic but I need to recharge.
< 1735941189 411848 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I really wanted to avoid using a fixed-point combinator but I think that my options are: Z combinator for Python, locals() hacks, or bytecode with code() to hand-write a while-loop.
< 1735941530 54655 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I wonder whether that's faster or slower than my BF interpreter in Esimpl
< 1735941563 28518 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :although mine was implementing bignum BF, yours can easily be adapted to that
< 1735941640 329611 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :(it ships with the Esimpl interpreter linked on the wiki, maybe I should make it a separate link)
< 1735941950 748950 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ais523: don't you have double exponentially slow bf interpreters for one of these machines with only counters?
< 1735942668 221603 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :possibly, although I'm not sure I ever actually wrote one
< 1735942686 819388 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I thought Esimpl would be an interesting comparison because the interpreter isn't hugely slow, but it is limited by having only stacks to store data in
< 1735942737 739225 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :if you pick a super-slow language it isn't an interesting comparison
< 1735942879 803282 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :yeah
< 1735942971 36512 :int-e!~noone@int-e.eu PRIVMSG #esolangs :So you can have 2 stacks for data and 2 stacks for tracking the program and one more stack for tracking loop depth while skipping back and forth?
< 1735943020 676441 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(trying to wrap my head around the utility of having more than 2 stacks... this kind of separation of concerns should help)
< 1735943076 526870 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it's implemented Underload-style, two for data, one for program, one for holding the current loop while making a copy of it (which is a full semideque not just a stack as it gets looped round twice), and one for counting nesting depth
< 1735943088 770311 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and one as a temporary while lexing
< 1735943544 150064 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1735945185 583203 PRIVMSG #esolangs :14[[07User:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149346&oldid=149098 5* 03Waffelz 5* (-21) 10
< 1735948347 854460 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1735948681 110339 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1735949037 210111 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1735949179 294703 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735955318 478303 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Well, I failed. I have a pile of code: https://bpa.st/LNJHYYC2ITORTPJT54NYCEAGXM
< 1735955352 44516 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :It doesn't work. Or maybe it works? But it causes key errors that should be impossible on Lost Kingdom, which means I fucked something up in a dire way. Maybe the parser's shit.
< 1735955389 976213 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I can't get it to actually print out any non-trivial looping construct. mandel.b pegs my CPU and doesn't achieve anything.
< 1735955431 868576 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Anyway, good waste of an afternoon. Maybe there's something to learn from this.
< 1735955851 862109 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1735956687 17457 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1735957058 663807 PRIVMSG #esolangs :14[[07Python But WORST, at least in Esolang Wiki14]]4 10 02https://esolangs.org/w/index.php?diff=149347&oldid=149312 5* 03PrySigneToFry 5* (+89) 10
> 1735963241 557253 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149348&oldid=148833 5* 03PrySigneToFry 5* (+1128) 10/* Your username */ new section
> 1735963371 64738 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149349&oldid=148142 5* 03PrySigneToFry 5* (-23007) 10Clear the talking page
> 1735963412 146011 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Archive/2024 9 20 to 2025 1 414]]4 N10 02https://esolangs.org/w/index.php?oldid=149350 5* 03PrySigneToFry 5* (+23201) 10Archived
> 1735963445 986965 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Archive14]]4 10 02https://esolangs.org/w/index.php?diff=149351&oldid=139984 5* 03PrySigneToFry 5* (+28) 10
> 1735963744 379324 PRIVMSG #esolangs :14[[07UserEdited14]]4 10 02https://esolangs.org/w/index.php?diff=149352&oldid=149007 5* 03PrySigneToFry 5* (+289) 10
> 1735963782 473815 PRIVMSG #esolangs :14[[07UserEdited14]]4 10 02https://esolangs.org/w/index.php?diff=149353&oldid=149352 5* 03PrySigneToFry 5* (-1) 10
> 1735963872 693128 PRIVMSG #esolangs :14[[07PokBattle14]]4 M10 02https://esolangs.org/w/index.php?diff=149354&oldid=148563 5* 03PrySigneToFry 5* (+7) 10
> 1735966362 426653 PRIVMSG #esolangs :14[[07Fusionscript14]]4 10 02https://esolangs.org/w/index.php?diff=149355&oldid=149300 5* 03PrySigneToFry 5* (+99) 10
< 1735968301 952829 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1735968632 634245 PRIVMSG #esolangs :14[[07TapeFuck14]]4 M10 02https://esolangs.org/w/index.php?diff=149356&oldid=147869 5* 03PythonshellDebugwindow 5* (+94) 10Categories
> 1735968758 602010 PRIVMSG #esolangs :14[[07Queue-based esolang14]]4 M10 02https://esolangs.org/w/index.php?diff=149357&oldid=148160 5* 03PythonshellDebugwindow 5* (+104) 10Categories
> 1735968846 177860 PRIVMSG #esolangs :14[[07Def run(t):14]]4 M10 02https://esolangs.org/w/index.php?diff=149358&oldid=148033 5* 03PythonshellDebugwindow 5* (+14) 10Lowercase
> 1735969050 123119 PRIVMSG #esolangs :14[[07GotoLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149359&oldid=148201 5* 03PythonshellDebugwindow 5* (+92) 10Categories
> 1735969129 637958 PRIVMSG #esolangs :14[[07BrainfXX14]]4 M10 02https://esolangs.org/w/index.php?diff=149360&oldid=136886 5* 03PythonshellDebugwindow 5* (+38) 10See also
> 1735969276 789061 PRIVMSG #esolangs :14[[07The Genetic Computer14]]4 M10 02https://esolangs.org/w/index.php?diff=149361&oldid=148441 5* 03PythonshellDebugwindow 5* (+66) 10Categories
> 1735969386 873148 PRIVMSG #esolangs :14[[07Albuquerque challenge/exampled to itself14]]4 M10 02https://esolangs.org/w/index.php?diff=149362&oldid=148244 5* 03PythonshellDebugwindow 5* (+32) 10Back
> 1735970303 876371 PRIVMSG #esolangs :14[[07Brainrot14]]4 10 02https://esolangs.org/w/index.php?diff=149363&oldid=148267 5* 03PythonshellDebugwindow 5* (+102) 10Disambiguation
> 1735970411 185820 PRIVMSG #esolangs :14[[07Brainrot (Yayimhere)14]]4 M10 02https://esolangs.org/w/index.php?diff=149364&oldid=148273 5* 03PythonshellDebugwindow 5* (+163) 10Lowercase, categories
> 1735970444 178473 PRIVMSG #esolangs :14[[07Brainrot14]]4 M10 02https://esolangs.org/w/index.php?diff=149365&oldid=149363 5* 03PythonshellDebugwindow 5* (+0) 10Capitalisation
> 1735970644 512849 PRIVMSG #esolangs :14[[07Brainrot (Theothetruenerd)14]]4 10 02https://esolangs.org/w/index.php?diff=149366&oldid=148265 5* 03PythonshellDebugwindow 5* (+152) 10Categories, see also
> 1735970706 406284 PRIVMSG #esolangs :14[[07Gen Alpha14]]4 M10 02https://esolangs.org/w/index.php?diff=149367&oldid=133257 5* 03PythonshellDebugwindow 5* (+87) 10See also
> 1735970790 158016 PRIVMSG #esolangs :14[[07Gen Alpha Brainrot14]]4 M10 02https://esolangs.org/w/index.php?diff=149368&oldid=133258 5* 03PythonshellDebugwindow 5* (+78) 10See also
> 1735970846 667370 PRIVMSG #esolangs :14[[07Rizzlang14]]4 M10 02https://esolangs.org/w/index.php?diff=149369&oldid=136621 5* 03PythonshellDebugwindow 5* (+89) 10See also
> 1735971047 360462 PRIVMSG #esolangs :14[[0716x16 RGB2 panel14]]4 M10 02https://esolangs.org/w/index.php?diff=149370&oldid=148296 5* 03PythonshellDebugwindow 5* (+66) 10Categories
> 1735971279 894082 PRIVMSG #esolangs :14[[07User:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149371&oldid=149346 5* 03Waffelz 5* (+10) 10
> 1735972109 73397 PRIVMSG #esolangs :14[[07Mobius brainfuck14]]4 10 02https://esolangs.org/w/index.php?diff=149372&oldid=148290 5* 03PythonshellDebugwindow 5* (+758) 10Link, interpreter, categories
> 1735972249 633830 PRIVMSG #esolangs :14[[07Mutual Modification Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149373&oldid=148325 5* 03PythonshellDebugwindow 5* (+68) 10Link, header, categories
> 1735972537 289347 PRIVMSG #esolangs :14[[07TuringLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149374&oldid=148390 5* 03PythonshellDebugwindow 5* (+63) 10Wikilink, categories
> 1735972999 861096 PRIVMSG #esolangs :14[[07Halting problem (language)14]]4 M10 02https://esolangs.org/w/index.php?diff=149375&oldid=148351 5* 03PythonshellDebugwindow 5* (+121) 10Categories
> 1735973451 340678 PRIVMSG #esolangs :14[[07Brainstack14]]4 M10 02https://esolangs.org/w/index.php?diff=149376&oldid=74712 5* 03PythonshellDebugwindow 5* (+57) 10Distinguish confusion
> 1735973774 461514 PRIVMSG #esolangs :14[[07Brainstack(islptng)14]]4 M10 02https://esolangs.org/w/index.php?diff=149377&oldid=148516 5* 03PythonshellDebugwindow 5* (+118) 10Categories
> 1735973839 491086 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149378&oldid=147888 5* 03PythonshellDebugwindow 5* (+49) 10Distinguish confusion
> 1735974408 753364 PRIVMSG #esolangs :14[[07Directions14]]4 M10 02https://esolangs.org/w/index.php?diff=149379&oldid=148707 5* 03PythonshellDebugwindow 5* (+205) 10Categories
> 1735975048 905233 PRIVMSG #esolangs :14[[07Brainstack(islptng)14]]4 10 02https://esolangs.org/w/index.php?diff=149380&oldid=149377 5* 03ZCX islptng 5* (-2) 10Wrong category!
< 1735978796 471453 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735982563 462663 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1735983633 421362 PRIVMSG #esolangs :14[[07Constructible14]]4 N10 02https://esolangs.org/w/index.php?oldid=149381 5* 03Hakerh400 5* (+1481) 10+[[Constructible]]
> 1735983663 354023 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149382&oldid=149275 5* 03Hakerh400 5* (+20) 10+[[Constructible]]
> 1735983680 69964 PRIVMSG #esolangs :14[[07User:Hakerh40014]]4 10 02https://esolangs.org/w/index.php?diff=149383&oldid=144748 5* 03Hakerh400 5* (+20) 10+[[Constructible]]
< 1735984076 541932 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1735987854 618341 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1735987995 933760 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds
> 1735988705 657465 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149384&oldid=149112 5* 03Jan jelo 5* (+832) 10
< 1735989093 188914 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1735989885 60886 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149385&oldid=149384 5* 03Jan jelo 5* (+657) 10
> 1735989931 413385 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149386&oldid=149385 5* 03Jan jelo 5* (+13) 10/* Looping */
> 1735990045 977739 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=149387&oldid=149386 5* 03Jan jelo 5* (+13) 10/* Looping */
< 1735990524 831709 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1735990635 550263 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149388&oldid=149325 5* 03Jan jelo 5* (+1) 10/* Article */
< 1735992223 337576 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1735992291 492344 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1735993452 998198 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :
< 1735993601 741568 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1735996718 369454 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1735999098 34860 :molson_!~molson@2605-4A80-2101-99D0-876A-B6B9-AAA8-7CB-dynamic.midco.net JOIN #esolangs molson :realname
< 1735999299 383506 :molson!~molson@2605-4A80-2101-99D0-D3CE-EF6F-645F-64A7-dynamic.midco.net QUIT :Ping timeout: 276 seconds
< 1736002042 164771 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736005015 193552 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736006403 118700 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736006797 886850 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736007161 930382 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736008464 779604 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1736009079 641130 :Artea!~Lufia@artea.pt QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1736009953 553053 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
> 1736010438 519973 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Juanp32 5*  10New user account
< 1736010619 887976 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 264 seconds
> 1736011924 591526 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149389&oldid=149219 5* 03Juanp32 5* (+681) 10/* Introductions */
> 1736012192 652057 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 N10 02https://esolangs.org/w/index.php?oldid=149390 5* 03Juanp32 5* (+307) 10making userpage :)
< 1736012551 969553 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection
< 1736012728 998684 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736012737 81986 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :@metar EGBB
< 1736012744 146316 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs :Request failed.
< 1736012865 148607 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse
> 1736013396 743726 PRIVMSG #esolangs :14[[07Array?14]]4 10 02https://esolangs.org/w/index.php?diff=149391&oldid=146013 5* 0347 5* (-64) 10/* Commands */
> 1736013417 82278 PRIVMSG #esolangs :14[[07Array?14]]4 10 02https://esolangs.org/w/index.php?diff=149392&oldid=149391 5* 0347 5* (+8) 10/* Commands */
> 1736013561 910437 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149393&oldid=148522 5* 0347 5* (-1) 10/* Syntax */
< 1736013974 385043 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736014024 926277 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149394&oldid=149393 5* 0347 5* (+167) 10/* Hello, world! */
> 1736014223 373423 PRIVMSG #esolangs :14[[07Definition14]]4 10 02https://esolangs.org/w/index.php?diff=149395&oldid=149394 5* 0347 5* (+92) 10/* Syntax */
< 1736014884 603339 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de QUIT :Quit: Leaving
> 1736014908 356556 PRIVMSG #esolangs :14[[07!aBF'14]]4 10 02https://esolangs.org/w/index.php?diff=149396&oldid=144515 5* 0347 5* (-1) 10golfed the truth-machine a bit more
> 1736014995 933959 PRIVMSG #esolangs :14[[07!lyriclydemoteestablishcommunism!14]]4 10 02https://esolangs.org/w/index.php?diff=149397&oldid=148748 5* 0347 5* (-70) 10the batch implementation has output
< 1736015044 962181 :rodgort!~rodgort@static.38.6.217.95.clients.your-server.de JOIN #esolangs * :rodgort
> 1736015065 490413 PRIVMSG #esolangs :14[[07!aBF'14]]4 10 02https://esolangs.org/w/index.php?diff=149398&oldid=149396 5* 0347 5* (+1) 10/* Examples */
> 1736015140 646437 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149399&oldid=141357 5* 0347 5* (+0) 10/* Syntax */
> 1736015154 778439 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149400&oldid=149399 5* 0347 5* (+0) 10/* Truth-machine */
> 1736015190 827081 PRIVMSG #esolangs :14[[07!14]]4 10 02https://esolangs.org/w/index.php?diff=149401&oldid=149400 5* 0347 5* (+1) 10/* Syntax */
< 1736015458 138019 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736015562 621447 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1736015633 565391 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736015801 584173 PRIVMSG #esolangs :14[[07Queue-based esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149402&oldid=149357 5* 0347 5* (+57) 10/* Interpreters */
> 1736016083 78358 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149403&oldid=138739 5* 0347 5* (-34) 10/* Infinite loop */
> 1736016171 505243 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149404&oldid=149403 5* 0347 5* (-287) 10/* Truth-machine */
> 1736016195 621638 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149405&oldid=149404 5* 0347 5* (-22) 10/* Commands */
> 1736016337 737137 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149406&oldid=149405 5* 0347 5* (-125) 10/* Examples */
> 1736016398 821638 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149407&oldid=149406 5* 0347 5* (+68) 10/* Commands */
> 1736016544 680950 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149408&oldid=149407 5* 0347 5* (-22) 10
> 1736016562 513769 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149409&oldid=149408 5* 0347 5* (-8) 10/* Commands */
> 1736016842 411786 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149410&oldid=149409 5* 0347 5* (+35) 10/* Commands */
> 1736016939 420579 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149411&oldid=149410 5* 0347 5* (-44) 10/* Commands */
< 1736017356 15196 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736017926 907252 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736019425 504573 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Is there a way in GNU C to tell the compiler that a specific constant is that the compiler can assume that it remains constant while the program is running but is not allowed to assume what its value is at compile time (possibly because the value will be changed in the executable file before the program runs)?
< 1736019579 828691 :APic!apic@apic.name PRIVMSG #esolangs :Good Question
< 1736019582 115669 :APic!apic@apic.name PRIVMSG #esolangs :Good Night!
< 1736019757 397944 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: yes, I think if you declare a global variable as const then the compiler is allowed to assume that its value can't be changed but you can still use an initializer whose value isn't known at compiler time, such as a function call
< 1736019781 723784 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :in fact I think that works even for local variables
< 1736019889 165269 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but the actual object has to be declared const, just a const pointer doesn't guarantee that what it's pointing to can't change 
< 1736019924 948198 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :For local variables that will make sense, but I mean whose value is initialized before the program runs (how this is done is not necessarily known to the compiler; one way would be modifying the executable file by something other than the compiler), so it is not initialized by a function call or something like that.
< 1736019976 963643 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :You can give it `extern` linkage while preserving the `const` modifiers. IIRC this is the right way to do it; you could pretend that the value is known to the linker but not the compiler.
< 1736019999 67403 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :OK
< 1736020053 283515 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :If the goal is to force the compiler to not do `volatile` or PLT reads all the time, though, I'm not sure. It'd definitely be a GNU-specific extension that I haven't seen before.
< 1736020117 583132 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :zzo38: if the object isn't large then you could just make a copy into a const variable and use that copy
< 1736020156 357386 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but I don't think the compiler can do much global optimizations about the value being constant anyway
< 1736020162 803060 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :only local ones
< 1736020175 754653 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :there was also a relevant function attribute I think
< 1736020204 274545 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736020305 20361 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :https://gcc.gnu.org/onlinedocs/gcc-14.2.0/gcc/Common-Function-Attributes.html#index-const-function-attribute
< 1736020320 780286 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :the return value of such a function can't change throughout the program
< 1736020325 538890 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but that too only helps for small objects
< 1736021193 983594 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736022616 750025 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1736023004 969413 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736023660 262817 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736024484 433995 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736024992 928577 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736024993 247011 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 15.10, score 40.33, rank 3/47
< 1736025170 645541 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :two_thirds has a very similar win/loss profile to impatience2, because it's in the same general group of strategies, but should be more stable (impatience2 can be exploited by making a large change to your flag, two_thirds can't be)
< 1736025554 548044 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736026155 224735 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736026804 815240 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736028089 347627 PRIVMSG #esolangs :14[[07'interbasic14]]4 10 02https://esolangs.org/w/index.php?diff=149412&oldid=149411 5* 03Ractangle 5* (+6) 10/* Truth-machine */
> 1736028311 959899 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149413&oldid=149068 5* 03Ractangle 5* (+153) 10/* $+-? */
> 1736030854 721237 PRIVMSG #esolangs :14[[07Sakana14]]4 10 02https://esolangs.org/w/index.php?diff=149414&oldid=133735 5* 03TheCanon2 5* (+230) 10Added warning
< 1736030893 392455 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736032113 498691 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736032274 396752 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736032319 366941 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
> 1736032835 919972 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 N10 02https://esolangs.org/w/index.php?oldid=149415 5* 03Jan jelo 5* (+4013) 10Created page with "This python program by [[User:Jan jelo]] compiles Minsky machine program into [[Blindfolded Arithmetic]] program.(using state 0 means halt,states start from state 1.) It uses 2^a*3^b to encode two counters in  1736033063 349509 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149416&oldid=149415 5* 03Jan jelo 5* (+43) 10
> 1736033132 171141 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149417&oldid=149416 5* 03Jan jelo 5* (+17) 10
> 1736033154 30162 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149418&oldid=149417 5* 03Jan jelo 5* (+0) 10
> 1736033194 355765 PRIVMSG #esolangs :14[[07User:Jan jelo/a BF interpreter in Haskell14]]4 10 02https://esolangs.org/w/index.php?diff=149419&oldid=149329 5* 03Jan jelo 5* (+0) 10
> 1736033235 673075 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149420&oldid=149086 5* 03TheCanon2 5* (+157) 10added debug version
> 1736033326 345258 PRIVMSG #esolangs :14[[07User talk:Waffelz14]]4 10 02https://esolangs.org/w/index.php?diff=149421&oldid=149127 5* 03Waffelz 5* (+86) 10/* waffelz' Talk Page */
> 1736035027 951318 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic14]]4 10 02https://esolangs.org/w/index.php?diff=149422&oldid=142352 5* 03Jan jelo 5* (+1206) 10/* Proof of Turing-completeness */
> 1736035217 350420 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic14]]4 10 02https://esolangs.org/w/index.php?diff=149423&oldid=149422 5* 03Jan jelo 5* (+6) 10/* Compile from Minsky machine */
< 1736035388 477542 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
> 1736035427 87741 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149424&oldid=149418 5* 03Jan jelo 5* (+681) 10
< 1736035513 968923 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
> 1736035741 410094 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 10 02https://esolangs.org/w/index.php?diff=149425&oldid=149424 5* 03Jan jelo 5* (+6) 10
> 1736036429 757479 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149426&oldid=149388 5* 03Jan jelo 5* (+158) 10
> 1736036469 959490 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149427&oldid=149301 5* 03Jan jelo 5* (+21) 10
> 1736036693 670690 PRIVMSG #esolangs :14[[07/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149428&oldid=149427 5* 03Jan jelo 5* (+4) 10
> 1736037024 31283 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149429&oldid=149426 5* 03Jan jelo 5* (+23) 10
> 1736037041 66780 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149430&oldid=149429 5* 03Jan jelo 5* (+1) 10
> 1736037439 61990 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=149431&oldid=149328 5* 03Jan jelo 5* (+57) 10/* Brainfuck interpreter */
> 1736038490 773158 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149432&oldid=149425 5* 03Jan jelo 5* (-52) 10
> 1736039844 429122 PRIVMSG #esolangs :14[[07Blindfolded Arithmetic/compile from Minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149433&oldid=149432 5* 03Jan jelo 5* (+3) 10
> 1736041754 666581 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=149434&oldid=148347 5* 03Jan jelo 5* (+87) 10/* Real Quines */
< 1736043152 274960 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736043644 532263 PRIVMSG #esolangs :14[[07Pytecode14]]4 N10 02https://esolangs.org/w/index.php?oldid=149435 5* 03BestCoder 5* (+306) 10Created page with "Python bytecode == examples == === hello world ===   3           0 LOAD_GLOBAL              0 (print)               2 LOAD_CONST               1 ('hello world')               4 CALL_FUNCTION            1               6 POP_TOP               8 LOAD_CONST              
> 1736044308 475143 PRIVMSG #esolangs :14[[07List of quines14]]4 10 02https://esolangs.org/w/index.php?diff=149436&oldid=149434 5* 03Jan jelo 5* (+2358) 10/* Python (Python 3) */
> 1736044496 241333 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149437&oldid=149436 5* 03Jan jelo 5* (+0) 10/* Python (Python 3) */
< 1736046304 133339 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1736046322 375325 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736046335 105593 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
< 1736046394 585279 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
> 1736047701 721350 PRIVMSG #esolangs :14[[07Direction14]]4 10 02https://esolangs.org/w/index.php?diff=149438&oldid=138338 5* 03BestCoder 5* (+4) 10/* 321 program */
> 1736047724 455026 PRIVMSG #esolangs :14[[07Direction14]]4 10 02https://esolangs.org/w/index.php?diff=149439&oldid=149438 5* 03BestCoder 5* (+0) 10/* 321 program */
< 1736050267 304248 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736052344 924298 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=149440&oldid=133617 5* 03BestCoder 5* (+176) 10
< 1736052416 725864 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :The new calendar for this year does not have seasons
> 1736052545 670457 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=149441&oldid=149440 5* 03BestCoder 5* (+223) 10
> 1736059776 837719 PRIVMSG #esolangs :14[[07User:Tommyaweosme/BRING BACK THE OLD SANDBOX14]]4 10 02https://esolangs.org/w/index.php?diff=149442&oldid=149110 5* 03PrySigneToFry 5* (+70) 10
< 1736061418 439928 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736062109 992891 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736063252 593614 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736065078 896585 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736065631 974531 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736065711 425574 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736066574 743333 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: Textual IRC Client: www.textualapp.com
< 1736066600 858711 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736067497 874509 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736068405 232450 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
< 1736071051 985453 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736071612 472832 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5*  10moved [[02Hashmark10]] to [[ITECAAPL]]
> 1736071675 71100 PRIVMSG #esolangs :14[[07ITECAAPL14]]4 10 02https://esolangs.org/w/index.php?diff=149445&oldid=149443 5* 0347 5* (+35) 10
> 1736072748 208640 PRIVMSG #esolangs :14[[07Ilo nanpa sitelen14]]4 N10 02https://esolangs.org/w/index.php?oldid=149446 5* 03EvyLah 5* (+406) 10create base page but I need to finish it later
> 1736072756 689654 PRIVMSG #esolangs :14[[07Ilo nanpa sitelen14]]4 M10 02https://esolangs.org/w/index.php?diff=149447&oldid=149446 5* 03EvyLah 5* (-1) 10
< 1736072878 383192 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736073741 680290 PRIVMSG #esolangs :14[[07OmegaLang14]]4 N10 02https://esolangs.org/w/index.php?oldid=149448 5* 03PrySigneToFry 5* (+8725) 10Created page with "OmegaLang is designed by PSTF.  = Language Overview = OmegaLang is an object-oriented programming language that uses non-extreme-esoteric syntax to programming. It is powerful, and easy to learn but hard to complete mastery its principle. The language most inspi
> 1736074158 931231 PRIVMSG #esolangs :14[[07User talk:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff14]]4 10 02https://esolangs.org/w/index.php?diff=149449&oldid=149082 5* 03PrySigneToFry 5* (+783) 10
> 1736074297 9547 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149450&oldid=145256 5* 03PrySigneToFry 5* (+429) 10
> 1736074418 290843 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149451&oldid=148424 5* 03PrySigneToFry 5* (+441) 10/* To get code-golfing, I recommend to use the Base-100. */ new section
< 1736074712 202439 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736074876 980460 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149452&oldid=149413 5* 03PrySigneToFry 5* (+176) 10
> 1736075107 857721 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149453&oldid=131339 5* 03PrySigneToFry 5* (+286) 10
> 1736075417 339703 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149454&oldid=149453 5* 03PrySigneToFry 5* (+451) 10Both type 12 and type 13 are designed and implemented by PSTF.
> 1736075475 635982 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149455&oldid=149454 5* 03PrySigneToFry 5* (-8) 10Fixed interpreter
> 1736075598 285563 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149456&oldid=149455 5* 03PrySigneToFry 5* (+18) 10
< 1736075737 277360 :FreeFull!~freefull@etj133.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 244 seconds
< 1736075856 313030 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1736076705 643326 PRIVMSG #esolangs :14[[07JCLN14]]4 10 02https://esolangs.org/w/index.php?diff=149457&oldid=125659 5* 03Kaveh Yousefi 5* (+205) 10Introduced an examples section whose incipial member constitutes an odd-numbered line jumper.
> 1736076742 751951 PRIVMSG #esolangs :14[[07JCLN14]]4 10 02https://esolangs.org/w/index.php?diff=149458&oldid=149457 5* 03Kaveh Yousefi 5* (+157) 10Added a hyperlink to my implementation of the JCLN programming language on GitHub and altered the Unimplemented category tag to Implemented.
< 1736077107 27938 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1736078550 4057 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds
< 1736078715 476257 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736079534 334554 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :
< 1736079549 969981 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1736080252 590394 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736080711 301145 :APic!apic@apic.name PRIVMSG #esolangs :Celebrate Mungday! Hail Eris!      😇
> 1736084802 343131 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149459&oldid=149382 5* 03PrySigneToFry 5* (+16) 10/* O */
< 1736085068 304156 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot QUIT :Ping timeout: 244 seconds
< 1736085165 198583 :simcop2387!~simcop238@perlbot/patrician/simcop2387 QUIT :Ping timeout: 260 seconds
> 1736085210 895289 PRIVMSG #esolangs :14[[07+14]]4 10 02https://esolangs.org/w/index.php?diff=149460&oldid=141272 5* 03PrySigneToFry 5* (+119) 10
> 1736085568 2276 PRIVMSG #esolangs :14[[07Anti-Plushie language/PSTF14]]4 N10 02https://esolangs.org/w/index.php?oldid=149461 5* 03PrySigneToFry 5* (+565) 10Created page with "PSTF also have another APL(Anti-Plushie Language, not that APL).  == Commands == It is same as brainfuck, except: # If your program contains ., then output  then terminate. # If your program lets a cell to be 2 or 50, th
> 1736085639 628940 PRIVMSG #esolangs :14[[07User:PrySigneToFry/ constant14]]4 M10 02https://esolangs.org/w/index.php?diff=149462&oldid=142259 5* 03PrySigneToFry 5* (-2) 10
> 1736085712 876552 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=149463&oldid=142264 5* 03PrySigneToFry 5* (+103) 10
> 1736085993 339928 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149464&oldid=149331 5* 0347 5* (+25) 10/* Tommyawsome */
> 1736086024 7982 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149465&oldid=149464 5* 0347 5* (-43) 10/* Tommyawsome */
< 1736086116 301743 :simcop2387!~simcop238@perlbot/patrician/simcop2387 JOIN #esolangs simcop2387 :ZNC - https://znc.in
< 1736086196 429666 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot JOIN #esolangs perlbot :ZNC - https://znc.in
> 1736086646 746297 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149466&oldid=148357 5* 0347 5* (+66) 10
> 1736086658 203556 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149467&oldid=149466 5* 0347 5* (-1) 10
> 1736086868 286528 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149468&oldid=149467 5* 0347 5* (-1) 10/* Python3 */
< 1736087576 922989 :Everything!~Everythin@46-133-12-19.mobile.vf-ua.net JOIN #esolangs Everything :Everything
< 1736087795 702884 :Everything!~Everythin@46-133-12-19.mobile.vf-ua.net QUIT :Read error: Connection reset by peer
> 1736088437 865607 PRIVMSG #esolangs :14[[07Snakel/Syntax14]]4 10 02https://esolangs.org/w/index.php?diff=149469&oldid=147797 5* 0347 5* (+114) 10
> 1736088491 648297 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=149470&oldid=149468 5* 0347 5* (-3) 10/* Python3 */
< 1736088649 276199 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736090438 788132 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149471&oldid=146627 5* 03Tommyaweosmalt 5* (+317) 10
> 1736090490 223346 PRIVMSG #esolangs :14[[07User:Tommyaweosmalt14]]4 10 02https://esolangs.org/w/index.php?diff=149472&oldid=143126 5* 03Tommyaweosmalt 5* (+122) 10
> 1736090916 455703 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149473&oldid=149471 5* 03ZCX islptng 5* (+648) 10/*  */
> 1736091032 878110 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149474&oldid=149473 5* 03ZCX islptng 5* (+112) 10/*  */
< 1736095275 611352 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
> 1736096381 307713 PRIVMSG #esolangs :14[[07Lack14]]4 N10 02https://esolangs.org/w/index.php?oldid=149475 5* 03Dmiz 5* (+1572) 10Created page with "Lack is are an Esolang Based In Cells  The Commands Are:   {| class="wikitable" |+  |- ! Command !! Description |- | > || change the pointer by 1 |- | < || change the pointer by -1 |- | + || add 1 in pointer cell |- | - || subtract 1 in pointer cell |- | . || add ascii of poi
< 1736097151 258586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736097169 48059 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :you might know me as juanp32 on the wiki
< 1736097186 651 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :i made an esolang but i wanna name it before publishonh
< 1736097189 170594 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :https://pastebin.com/MnfniQ5s
< 1736097202 36953 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :any suggestions??
< 1736097278 288343 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :im out of ideas
< 1736097667 246363 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :ok seems like all of irc is dead today (even the usually active channels)
< 1736097680 264327 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736097768 33631 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736097773 587695 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
> 1736099235 749241 PRIVMSG #esolangs :14[[07User:Win7HE14]]4 10 02https://esolangs.org/w/index.php?diff=149476&oldid=149286 5* 03Win7HE 5* (+38) 10/* Eso (redirect) */
> 1736099293 252964 PRIVMSG #esolangs :14[[07Hyperinotoidion14]]4 10 02https://esolangs.org/w/index.php?diff=149477&oldid=148204 5* 03Win7HE 5* (+0) 10
> 1736099338 951208 PRIVMSG #esolangs :14[[07Template talk:Stub14]]4 10 02https://esolangs.org/w/index.php?diff=149478&oldid=112080 5* 03Win7HE 5* (+280) 10
> 1736100334 756595 PRIVMSG #esolangs :14[[07Emmental/Printing Code That Prints Code14]]4 N10 02https://esolangs.org/w/index.php?oldid=149479 5* 03Win7HE 5* (+4370) 10Created page with "its pretty large  #35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#46.#35.#53.#54.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#
> 1736100365 173036 PRIVMSG #esolangs :14[[07Emmental/Printing Code That Prints Code14]]4 10 02https://esolangs.org/w/index.php?diff=149480&oldid=149479 5* 03Win7HE 5* (+13) 10
> 1736100757 668808 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149481&oldid=149475 5* 03Dmiz 5* (+323) 10
> 1736100777 266991 PRIVMSG #esolangs :14[[07Branjunk14]]4 10 02https://esolangs.org/w/index.php?diff=149482&oldid=138857 5* 03Win7HE 5* (-2) 10code stuff and stuff like grammar
> 1736100942 56985 PRIVMSG #esolangs :14[[07Tommyaweosme unary14]]4 10 02https://esolangs.org/w/index.php?diff=149483&oldid=137203 5* 03Win7HE 5* (+113) 10
> 1736100984 823915 PRIVMSG #esolangs :14[[07Tommyaweosme unary14]]4 10 02https://esolangs.org/w/index.php?diff=149484&oldid=149483 5* 03Win7HE 5* (+80) 10
> 1736101100 180485 PRIVMSG #esolangs :14[[07Talk:Branjunk14]]4 N10 02https://esolangs.org/w/index.php?oldid=149485 5* 03Win7HE 5* (+106) 10Created page with "i decided to make changes --~~~~"
> 1736101251 57333 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=149486&oldid=148829 5* 03Win7HE 5* (+90) 10
< 1736101466 61255 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736101518 356722 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 N10 02https://esolangs.org/w/index.php?oldid=149487 5* 03Win7HE 5* (+56) 10Created page with "
{{:Special:Random}}" > 1736101565 555451 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149488&oldid=149487 5* 03Win7HE 5* (+19) 10 > 1736101724 93411 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149489&oldid=149488 5* 03Win7HE 5* (+32) 10 > 1736101775 986453 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149490&oldid=149489 5* 03Win7HE 5* (-1) 10 < 1736101845 146586 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds < 1736101911 915132 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord > 1736102040 299545 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149491&oldid=149490 5* 03Win7HE 5* (+96) 10 > 1736102123 125267 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149492&oldid=149491 5* 03Win7HE 5* (+20) 10 > 1736102183 259237 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149493&oldid=149492 5* 03Win7HE 5* (-80) 10 > 1736102268 333996 PRIVMSG #esolangs :14[[07User:Win7HE/random14]]4 10 02https://esolangs.org/w/index.php?diff=149494&oldid=149493 5* 03Win7HE 5* (+30) 10 < 1736102997 823408 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736103240 703738 PRIVMSG #esolangs :14[[07User:Dmiz14]]4 10 02https://esolangs.org/w/index.php?diff=149495&oldid=149187 5* 03Dmiz 5* (+59) 10 > 1736103487 582464 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149496&oldid=149481 5* 03Dmiz 5* (-1) 10 > 1736104223 267971 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Placeholding 5* 10New user account < 1736104288 81784 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds > 1736105401 281675 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149497&oldid=149389 5* 03Placeholding 5* (+435) 10 < 1736106185 422959 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1736106920 30496 PRIVMSG #esolangs :14[[07User:Placeholding14]]4 N10 02https://esolangs.org/w/index.php?oldid=149498 5* 03Placeholding 5* (+67) 10Created page with "hello. welcome to my user page.
i have nothing else to say here" < 1736107649 900502 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1736107851 921373 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1736108932 856619 PRIVMSG #esolangs :14[[07This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 M10 02https://esolangs.org/w/index.php?diff=149499&oldid=120450 5* 03TheCanon2 5* (+18) 10category < 1736109204 720587 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736109215 301287 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736110290 90289 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736110398 281869 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1736110624 105076 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736110749 957033 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736111686 169309 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149500&oldid=149452 5* 03Jan jelo 5* (+161) 10/* Muriel */ > 1736111769 603418 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=149501&oldid=149228 5* 03Jan jelo 5* (+168) 10/* Examples */ < 1736113105 376664 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1736113289 964320 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname < 1736115579 830673 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736115776 196339 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736116625 941111 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736117328 20721 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving < 1736117469 725358 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736119872 319656 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection < 1736119875 488643 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736119885 922343 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse < 1736121826 495881 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds < 1736121924 948544 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1736121981 377567 :chiselfu1e!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse < 1736122116 136608 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Ping timeout: 264 seconds < 1736123039 465626 :__monty__!~toonn@user/toonn QUIT :Quit: leaving > 1736123841 14306 PRIVMSG #esolangs :14[[07This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 M10 02https://esolangs.org/w/index.php?diff=149502&oldid=149499 5* 03PkmnQ 5* (+4) 10 > 1736127906 698818 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149503&oldid=149450 5* 03ZCX islptng 5* (+924) 10 > 1736129182 850976 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149504&oldid=149503 5* 03ZCX islptng 5* (+15) 10 > 1736129560 380231 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149505&oldid=149504 5* 03ZCX islptng 5* (+105) 10 > 1736130693 234521 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149506&oldid=149505 5* 03ZCX islptng 5* (+438) 10 > 1736131293 679933 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149507&oldid=149506 5* 03ZCX islptng 5* (+15) 10 > 1736131547 793861 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149508&oldid=149507 5* 03ZCX islptng 5* (+1140) 10 > 1736131859 183405 PRIVMSG #esolangs :14[[07User talk:ZCX islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149509&oldid=149508 5* 03ZCX islptng 5* (+223) 10 < 1736132633 611917 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Remote host closed the connection > 1736132805 390014 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03ZCX islptng 5* 10moved [[02SLet10]] to [[SLet (Old 2)]] > 1736132818 119293 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149512&oldid=149511 5* 03ZCX islptng 5* (-26) 10Blanked the page > 1736132886 84598 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149513&oldid=148680 5* 03ZCX islptng 5* (-10) 10 > 1736132962 314308 PRIVMSG #esolangs :14[[07SLet (Old 2)14]]4 10 02https://esolangs.org/w/index.php?diff=149514&oldid=149510 5* 03ZCX islptng 5* (-73) 10 > 1736133030 334849 PRIVMSG #esolangs :14[[07SLet (Old)14]]4 10 02https://esolangs.org/w/index.php?diff=149515&oldid=146586 5* 03ZCX islptng 5* (+29) 10 > 1736133155 598298 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149516&oldid=149512 5* 03ZCX islptng 5* (+156) 10 > 1736133202 758761 PRIVMSG #esolangs :14[[07Uhidklol14]]4 N10 02https://esolangs.org/w/index.php?oldid=149517 5* 03Juanp32 5* (+2636) 10make this page now that ive named it > 1736133218 957481 PRIVMSG #esolangs :14[[07SLet/Implementation14]]4 10 02https://esolangs.org/w/index.php?diff=149518&oldid=149197 5* 03ZCX islptng 5* (+10801) 10Undo revision [[Special:Diff/149197|149197]] by [[Special:Contributions/ZCX islptng|ZCX islptng]] ([[User talk:ZCX islptng|talk]]) > 1736133234 415345 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03ZCX islptng 5* 10moved [[02SLet/Implementation10]] to [[SLet (Old 2)/Implementation]] > 1736133245 463793 PRIVMSG #esolangs :14[[07SLet/Implementation14]]4 10 02https://esolangs.org/w/index.php?diff=149521&oldid=149520 5* 03ZCX islptng 5* (-33) 10Removed redirect to [[SLet (Old 2)/Implementation]] > 1736133271 94536 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149522&oldid=149459 5* 03Juanp32 5* (+15) 10/* U */ > 1736133272 889119 PRIVMSG #esolangs :14[[07SLet (Old 2)14]]4 10 02https://esolangs.org/w/index.php?diff=149523&oldid=149514 5* 03ZCX islptng 5* (-2) 10 > 1736133665 830316 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149524&oldid=149390 5* 03Juanp32 5* (+51) 10 > 1736133767 395389 PRIVMSG #esolangs :14[[07Uhidklol14]]4 M10 02https://esolangs.org/w/index.php?diff=149525&oldid=149517 5* 03Juanp32 5* (+13) 10oooops had to fix a typo > 1736134469 739025 PRIVMSG #esolangs :14[[07Uhidklol14]]4 M10 02https://esolangs.org/w/index.php?diff=149526&oldid=149525 5* 03Juanp32 5* (+245) 10made the info a bit clearer, pluss added an entry to the list > 1736134504 721872 PRIVMSG #esolangs :14[[07Talk:ABPLWNL14]]4 10 02https://esolangs.org/w/index.php?diff=149527&oldid=132149 5* 03BestCoder 5* (+371) 10/* actually you can "loop" forever unconditionally */ new section < 1736135340 916459 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 252 seconds < 1736140282 437488 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Optinyuroki: points 15.50, score 40.24, rank 3/47 (+1) > 1736141146 571816 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149528&oldid=149516 5* 03ZCX islptng 5* (+1456) 10 > 1736141804 906931 PRIVMSG #esolangs :14[[07BF Lite14]]4 10 02https://esolangs.org/w/index.php?diff=149529&oldid=120288 5* 03BestCoder 5* (+27) 10 > 1736141824 185926 PRIVMSG #esolangs :14[[07Category:MistakeInSpec14]]4 N10 02https://esolangs.org/w/index.php?oldid=149530 5* 03BestCoder 5* (+35) 10Created page with "when you make a mistake in the spec" > 1736142629 139091 PRIVMSG #esolangs :14[[07Talk:Autism14]]4 N10 02https://esolangs.org/w/index.php?oldid=149531 5* 03BestCoder 5* (+81) 10Created page with "I feel kinda offended ~~~" > 1736143484 205395 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149532&oldid=149528 5* 03ZCX islptng 5* (+976) 10 > 1736144074 121105 PRIVMSG #esolangs :14[[07Talk:Asd14]]4 N10 02https://esolangs.org/w/index.php?oldid=149533 5* 03BestCoder 5* (+41) 10Created page with "doesnt that mean autism spectrum disorder" > 1736144103 318132 PRIVMSG #esolangs :14[[07Esolang testing14]]4 N10 02https://esolangs.org/w/index.php?oldid=149534 5* 03BestCoder 5* (+1) 10Created page with "e" > 1736144113 279106 PRIVMSG #esolangs :14[[07Talk:Esolang testing14]]4 N10 02https://esolangs.org/w/index.php?oldid=149535 5* 03BestCoder 5* (+623) 10Created page with "--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~" < 1736146562 140530 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer > 1736148094 485309 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149536&oldid=149532 5* 03ZCX islptng 5* (+34) 10 < 1736152348 728448 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :Remote host closed the connection < 1736152664 902499 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736152689 95135 :b_jonas!~x@88.87.242.184 QUIT :Ping timeout: 265 seconds < 1736152792 442392 :b_jonas!~x@88.87.242.184 JOIN #esolangs * :b_jonas > 1736155452 68277 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149537&oldid=149456 5* 03None1 5* (-2) 10/* Dialects created in 2025 */ > 1736155595 928828 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149538&oldid=149537 5* 03None1 5* (+142) 10/* Example Programs */ Add examples > 1736155674 957272 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149539&oldid=149538 5* 03None1 5* (+113) 10/* Type 13 */ > 1736155764 473640 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149540&oldid=149539 5* 03None1 5* (+122) 10/* Type 13 */ > 1736155785 364980 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149541&oldid=149540 5* 03None1 5* (-19) 10/* type 11/Nil/APLWSI interpreter */ > 1736155835 737438 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149542&oldid=149541 5* 03None1 5* (+170) 10/* Interpreters */ > 1736155873 91459 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149543&oldid=149542 5* 03None1 5* (+27) 10 > 1736156683 385325 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149544&oldid=149500 5* 03None1 5* (+24) 10/* Type 1 and Type 2 and Type 6 and Type 7 and Type 9 and Type 10 */ > 1736156766 705540 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149545&oldid=149544 5* 03None1 5* (+12) 10/* Type 3 and Type 5 and Type 8 */ < 1736157301 410160 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736158511 227647 PRIVMSG #esolangs :14[[07Void14]]4 N10 02https://esolangs.org/w/index.php?oldid=149546 5* 03None1 5* (+2167) 10Created page with "'''Void''' is [[User:None1]]'s first esolang (that isn't a dialect of an old esolang) invented in 2025. ==Types== This esolang is an untyped one as it has only 1 type: '''void'''. Unlike the type with the same name in most practical languages, this type can not only store em > 1736158540 965197 PRIVMSG #esolangs :14[[07Void14]]4 10 02https://esolangs.org/w/index.php?diff=149547&oldid=149546 5* 03None1 5* (+4) 10 > 1736158629 838158 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149548&oldid=149522 5* 03None1 5* (+11) 10/* V */ > 1736158715 808784 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149549&oldid=148986 5* 03None1 5* (+57) 10/* My Esolangs */ < 1736159273 681165 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736159820 224864 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736159960 677433 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736160060 738987 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736160527 330712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736161248 251713 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736163950 564137 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :how do people typically combine macros in a language like lambda calculus? < 1736163974 58838 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :no, let me rephrase < 1736163997 404424 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :i have a language that has variables and named macros < 1736164021 211941 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :they're not functions so i don't have proper scoping for variables < 1736164065 926943 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :how do i do something like f(f(a,b), f(c,d)) without them stepping on each other's toes? < 1736165070 8899 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds < 1736165112 679214 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1736165365 926199 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :I don't think you can, if you mean that the "call" f(a,b) and the one for f(c,d) clobber the same variables < 1736165407 544185 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :or well hm, I guess if you transform it to a form where everything is done serially? foo = f(a,b); bar = f(c,d); baz = f(foo, bar); and generate uniue names for each intermediate stage < 1736165588 389646 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull < 1736166037 284789 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) < 1736166079 2104 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :isabella: I think you may be looking for "hygienic macros", see https://en.wikipedia.org/wiki/Hygienic_macro < 1736166230 188889 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :i think i'm going to go with a stack > 1736168887 159568 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03RedstoneMedia 5* 10New user account > 1736168989 159894 PRIVMSG #esolangs :14[[07User:Jan jelo/ASK calculus interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=149550 5* 03Jan jelo 5* (+1701) 10Created page with "This is a stack-based [[Ask-calculus]] interpreter in Python by [[User:Jan jelo]].
 def pop(x,l):  a=l.pop()  x.append(a)  if a==')':   i=1   while i:    a=l[-1]    x.append(l.pop())    if a=='(':i-=1    if a==')':i+=1  return  y=[];
< 1736169176 233111 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736169176 510578 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 15.90, score 42.60, rank 3/47 (+1)
> 1736169316 517997 PRIVMSG #esolangs :14[[07User:Jan jelo/ASK calculus interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=149551&oldid=149550 5* 03Jan jelo 5* (+35) 10
> 1736169368 566954 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149552&oldid=149430 5* 03Jan jelo 5* (+44) 10/* Intepreters */
< 1736169454 745080 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736169454 962946 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 16.10, score 42.96, rank 3/47 (--)
> 1736170195 122734 PRIVMSG #esolangs :14[[07Void14]]4 10 02https://esolangs.org/w/index.php?diff=149553&oldid=149547 5* 03None1 5* (+2) 10/* =Named functions */
< 1736170225 459720 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736170225 660317 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 16.26, score 43.38, rank 2/47 (+1)
< 1736170651 37268 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
> 1736171291 934768 PRIVMSG #esolangs :14[[07User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149554&oldid=149451 5* 03None1 5* (+557) 10/* To get code-golfing, I recommend to use the Base-100. */
< 1736172941 690720 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736172941 879788 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 17.88, score 47.69, rank 2/47 (--)
> 1736173420 453665 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Jan jelo 5*  10moved [[02User:Jan jelo/ASK calculus interpreter10]] to [[User:Jan jelo/SKA calculus interpreter]]
> 1736173452 265521 PRIVMSG #esolangs :14[[07User:Jan jelo/SKA calculus interpreter14]]4 10 02https://esolangs.org/w/index.php?diff=149557&oldid=149555 5* 03Jan jelo 5* (+13) 10
> 1736173701 808469 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 N10 02https://esolangs.org/w/index.php?oldid=149558 5* 03Juanp32 5* (+3854) 10im bored and randomly got this idea
> 1736173802 538544 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149559&oldid=149548 5* 03Juanp32 5* (+78) 10/* Non-alphabetic */
> 1736173818 894888 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149560&oldid=149552 5* 03Jan jelo 5* (+0) 10/* Intepreters */
> 1736173996 454249 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 10 02https://esolangs.org/w/index.php?diff=149561&oldid=149558 5* 03Juanp32 5* (+195) 10please tell me in what list this should go in the talk page
> 1736174067 265478 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149562&oldid=149561 5* 03Juanp32 5* (+6) 10oooops formatting
> 1736174140 221384 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149563&oldid=149562 5* 03Juanp32 5* (+18) 10DANGIT ACCIDENTALLY CLICKED SAVE INSTEAD OF PREVIEW lets assume both header and list edits were the same edit k?
> 1736174333 789740 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 M10 02https://esolangs.org/w/index.php?diff=149564&oldid=149563 5* 03Juanp32 5* (+0) 10this is it im not editing on mobile ever again. fat fingers i keep misclicking >:/
< 1736174744 726049 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
> 1736175181 95957 PRIVMSG #esolangs :14[[07IRC14]]4 M10 02https://esolangs.org/w/index.php?diff=149565&oldid=85668 5* 03Juanp32 5* (+0) 10/* Reserved words */  typo, said "voided" instead of "voiced"
< 1736175199 846722 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :typos suck
< 1736175455 612401 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
< 1736175455 899898 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.93, score 50.35, rank 2/47 (--)
> 1736175648 785727 PRIVMSG #esolangs :14[[07SLet14]]4 10 02https://esolangs.org/w/index.php?diff=149566&oldid=149536 5* 03ZCX islptng 5* (+100) 10
< 1736175835 441163 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736176666 931184 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736178239 660028 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736178704 609266 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736179007 428609 :molson__!~molson@2605-4A80-2101-99D0-168C-5969-D579-98E-dynamic.midco.net JOIN #esolangs molson :realname
> 1736179072 163892 PRIVMSG #esolangs :14[[07BF Joust strategies14]]4 10 02https://esolangs.org/w/index.php?diff=149567&oldid=149115 5* 03Ais523 5* (+2068) 10/* Cleared decoy detection */ a few of my programs have done this now and it seems pretty helpful in general  in fact, there are enough programs doing this to provide a metagame of countermeasures, and countermeasures to the countermeasures
> 1736179084 762245 PRIVMSG #esolangs :14[[07Talk:This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it14]]4 N10 02https://esolangs.org/w/index.php?oldid=149568 5* 03Aadenboy 5* (+362) 10Created page with "184 characters for an among us joke,, truly the demise of the british empire ~~~~"
< 1736179186 140433 :molson_!~molson@2605-4A80-2101-99D0-876A-B6B9-AAA8-7CB-dynamic.midco.net QUIT :Ping timeout: 248 seconds
< 1736179997 388856 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :hmm, two_thirds now ties with one program but beats all the rest, but nonetheless isn't in first place because many of the wins are very narrow
< 1736180042 73387 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I think that's probably correct; in a sense, backstop2 is "more impressive" because it beats most programs by large margins
< 1736180267 369297 :molson__!~molson@2605-4A80-2101-99D0-168C-5969-D579-98E-dynamic.midco.net QUIT :Quit: Leaving
< 1736180469 429512 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net JOIN #esolangs molson :realname
< 1736181696 502193 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net QUIT :Remote host closed the connection
< 1736181724 577217 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net JOIN #esolangs molson :realname
< 1736183910 358942 :isabella!izabera@user/meow/izabera PRIVMSG #esolangs :https://gist.github.com/izabera/8c541886c3992d328255944bc3de62c7   the thing from a few hours ago
< 1736184733 249015 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 244 seconds
< 1736185557 126583 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736186035 879746 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736186284 719293 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736187311 381959 :APic!apic@apic.name PRIVMSG #esolangs :Good Night!
> 1736187533 463343 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149569&oldid=149496 5* 03Dmiz 5* (+135) 10
> 1736187979 665160 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149570&oldid=149569 5* 03Dmiz 5* (+86) 10
< 1736188322 144733 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736188410 888338 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 272 seconds
< 1736188501 713545 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736188840 809278 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149571&oldid=149570 5* 03Dmiz 5* (-10) 10
< 1736190862 819353 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736191954 946919 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149572&oldid=149497 5* 03Buckets 5* (+327) 10
> 1736192007 862135 PRIVMSG #esolangs :14[[07Javagrid14]]4 M10 02https://esolangs.org/w/index.php?diff=149573&oldid=65225 5* 03Buckets 5* (+1) 10
< 1736192303 736384 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736193251 185424 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736193399 512029 PRIVMSG #esolangs :14[[07ETA14]]4 10 02https://esolangs.org/w/index.php?diff=149574&oldid=106485 5* 03Buckets 5* (+120) 10
< 1736194161 446251 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736194429 724285 PRIVMSG #esolangs :14[[07W)14]]4 M10 02https://esolangs.org/w/index.php?diff=149575&oldid=141114 5* 03Buckets 5* (+2) 10
< 1736194917 312719 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :isabella: Delightful, thanks for sharing.
< 1736195131 287712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736195397 267474 :__monty__!~toonn@user/toonn QUIT :Ping timeout: 244 seconds
< 1736195439 435520 :molson!~molson@2605-4A80-2101-99D0-8DE-E28F-63E9-EF27-dynamic.midco.net QUIT :Ping timeout: 260 seconds
< 1736195992 190769 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736196240 526707 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 N10 02https://esolangs.org/w/index.php?oldid=149576 5* 03Jan jelo 5* (+1901) 10Created page with "This is a [[JSFuck]] code generator in python by [[User:Jan jelo]]. 
 false='(![])' true=f'!{false}' _0=f'(+[])' _1=f'(+{true})' succ=lambda x:f'({x}+{_1})' _2=succ(_1) _3=succ(_2) _4=f'({_2}+{_2})' _5=f'({_2}+{_3})' _6=f'({_3}+{_3})' _7
> 1736196346 734163 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149577&oldid=149576 5* 03Jan jelo 5* (+10) 10
> 1736196627 45248 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149578&oldid=149577 5* 03Jan jelo 5* (+27) 10
> 1736196702 857318 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 M10 02https://esolangs.org/w/index.php?diff=149579&oldid=149560 5* 03Jan jelo 5* (+0) 10typo
< 1736196959 129907 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736197060 289197 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149580&oldid=149579 5* 03Jan jelo 5* (+41) 10/* Code generators */
> 1736197483 985002 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149581&oldid=149437 5* 03Jan jelo 5* (+22) 10/* Python (Python 3) */
> 1736197578 590636 PRIVMSG #esolangs :14[[07User:Jan jelo/a quine in python that contains a underload interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=149582 5* 03Jan jelo 5* (+2407) 10Created page with "This is a [[Quine]] program in python by [[User:Jan jelo]].  It contains a [[Underload]] interpreter. 
 def run(p):     stack=[]     program=p     while program:         x,program=program[0],program[1:] 
> 1736197662 872328 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=149583&oldid=149580 5* 03Jan jelo 5* (+87) 10
> 1736197939 421864 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149584&oldid=149465 5* 03Ractangle 5* (-6) 10/* Stuff to continue */
> 1736197987 1125 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149585&oldid=149584 5* 03Ractangle 5* (-8) 10/* Stuff to continue */
< 1736198211 595184 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736198212 536909 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149586&oldid=149578 5* 03Jan jelo 5* (-16) 10
> 1736198248 405099 PRIVMSG #esolangs :14[[07User:Jan jelo/JSFuck code generator14]]4 M10 02https://esolangs.org/w/index.php?diff=149587&oldid=149586 5* 03Jan jelo 5* (-1) 10
> 1736198277 251417 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Ractangle 5*  10moved [[02ITECAAPL10]] to [[Marb]]
> 1736198329 260535 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149590&oldid=149588 5* 03Ractangle 5* (-104) 10finishing this later
> 1736199731 874037 PRIVMSG #esolangs :14[[07User:Jan jelo/SKA calculus interpreter14]]4 10 02https://esolangs.org/w/index.php?diff=149591&oldid=149557 5* 03Jan jelo 5* (+193) 10
< 1736199960 986270 :molson!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 JOIN #esolangs molson :realname
< 1736199996 67223 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736200053 227625 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
< 1736200137 350757 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736201881 960322 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736201915 683586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736201979 534389 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736202467 76273 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736202483 677202 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736203046 967566 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736203448 436724 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149592&oldid=148332 5* 03Juanp32 5* (+171) 10
< 1736203668 339473 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736206528 471893 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149593&oldid=149524 5* 03Juanp32 5* (+149) 10since i made 2 languages i guess its time to make a list amirite
< 1736208244 655182 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds
< 1736208332 333657 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736209986 477241 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736210073 56251 PRIVMSG #esolangs :14[[07Lack14]]4 10 02https://esolangs.org/w/index.php?diff=149594&oldid=149571 5* 03Dmiz 5* (+63) 10
< 1736210485 932538 :chiselfu1e!~chiselfus@user/chiselfuse NICK :chiselfuse
< 1736213405 578094 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Optinyuroki: points 16.57, score 42.00, rank 3/47 (+1)
< 1736215848 435252 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736215856 118456 :Bowserinator_!Bowserinat@hellomouse/dev/bowserinator QUIT :Read error: Connection reset by peer
< 1736216741 384513 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736218497 274555 :ming!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736219348 22943 :molson_!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 JOIN #esolangs molson :realname
< 1736219413 108233 :ming!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 248 seconds
< 1736219494 973664 :molson!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 QUIT :Ping timeout: 260 seconds
< 1736219824 237027 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736224812 435096 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 246 seconds
< 1736224926 416143 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736225120 904725 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
< 1736225128 453392 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736225288 454493 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Max SendQ exceeded
< 1736225364 444824 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736230549 114987 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 248 seconds
< 1736234339 233329 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736235090 412424 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736235694 776720 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03I am islptng 5*  10New user account
> 1736235732 645959 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149595&oldid=149572 5* 03I am islptng 5* (+146) 10
> 1736235809 426061 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng10]] to [[User:I am islptng]]
> 1736235809 461010 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/List of "x bits, y bytes"10]] to [[User:I am islptng/List of "x bits, y bytes"]]
> 1736235809 501148 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/My rate to the user I know10]] to [[User:I am islptng/My rate to the user I know]]
> 1736235809 537027 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/Redirect10]] to [[User:I am islptng/Redirect]]
> 1736235809 573102 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/Sandbox10]] to [[User:I am islptng/Sandbox]]
> 1736235809 604610 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/TCP110]] to [[User:I am islptng/TCP1]]
> 1736235809 633090 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User:ZCX islptng/Template:Signature10]] to [[User:I am islptng/Template:Signature]]
> 1736235809 666348 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User talk:ZCX islptng10]] to [[User talk:I am islptng]]
> 1736235809 699995 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03I am islptng 5*  10moved [[02User talk:ZCX islptng/Sandbox10]] to [[User talk:I am islptng/Sandbox]]
> 1736235884 754161 PRIVMSG #esolangs :14[[07Template:User:ZCX islptng/Signature14]]4 10 02https://esolangs.org/w/index.php?diff=149614&oldid=147102 5* 03I am islptng 5* (-476) 10Blanked the page
> 1736236266 762425 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149615&oldid=148156 5* 03I am islptng 5* (+592) 10/* Please ban User:ZCX islptng. */ new section
> 1736237047 59689 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149616&oldid=149596 5* 03I am islptng 5* (+223) 10
> 1736237093 741209 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149617&oldid=149616 5* 03I am islptng 5* (+4) 10
> 1736237674 160967 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149618&oldid=149617 5* 03I am islptng 5* (+73) 10
> 1736238028 681518 PRIVMSG #esolangs :14[[07User:I am islptng/List of the users that is also in conwaylife.com14]]4 N10 02https://esolangs.org/w/index.php?oldid=149619 5* 03I am islptng 5* (+429) 10Created page with "I welcome everybody that is both on conwaylife.com and esolangs.org to edit it!
Incomplete list {|class=wikitable ! Esolangs.org name !! LifeWiki name !! ConwayLife Forums name !! How |- | I am islptng > 1736240298 201469 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149620&oldid=149590 5* 0347 5* (+77) 10 < 1736241339 889422 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736242756 48354 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736245132 11181 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds < 1736245513 829485 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k > 1736246049 47270 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149621&oldid=149620 5* 0347 5* (+87) 10 < 1736247134 113712 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736250226 540353 PRIVMSG #esolangs :14[[07!@$%^&*()+=14]]4 10 02https://esolangs.org/w/index.php?diff=149622&oldid=148771 5* 03Xyzzy 5* (+12) 10 > 1736250408 450043 PRIVMSG #esolangs :14[[07User:Xyzzy/Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149623 5* 03Xyzzy 5* (+3) 10Created page with "idk" < 1736251352 273413 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds < 1736251577 404243 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736252206 46183 PRIVMSG #esolangs :14[[07614]]4 10 02https://esolangs.org/w/index.php?diff=149624&oldid=145396 5* 0347 5* (-73) 10/* Online interpreters */ > 1736253174 135296 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Truthmachine.png10]]": Truth Machine for ChromaCode > 1736253427 215929 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Catstr.png10]]": String Cat Program for ChromaCode > 1736253480 543525 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Catnum.png10]]": Number Cat Program for ChromaCode > 1736253568 902012 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Xkcd221.png10]]": XKCD RNG for ChromaCode > 1736253709 349429 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CM Fibonacci.png10]]" > 1736253746 483951 PRIVMSG #esolangs :14[[07@everyone but they had to move to irc bcuz they got banned from discord14]]4 10 02https://esolangs.org/w/index.php?diff=149630&oldid=149564 5* 0347 5* (+41) 10/* errors */ > 1736253921 266927 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Factorial.png10]]" > 1736254035 961937 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Listevennumbers.png10]]" > 1736254106 194290 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Iseven.png10]]" > 1736254195 738501 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03QuantumV 5* 10uploaded "[[02File:CC Hi.png10]]" > 1736254801 850456 PRIVMSG #esolangs :14[[07ChromaCode14]]4 N10 02https://esolangs.org/w/index.php?oldid=149635 5* 03QuantumV 5* (+3317) 10Create page > 1736254951 123401 PRIVMSG #esolangs :14[[07ChromaCode14]]4 M10 02https://esolangs.org/w/index.php?diff=149636&oldid=149635 5* 03QuantumV 5* (-6) 10 > 1736255035 421790 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149637&oldid=149559 5* 03QuantumV 5* (+18) 10add chromacode > 1736255063 612365 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149638&oldid=149637 5* 03QuantumV 5* (-1) 10 > 1736255506 213374 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=149639&oldid=148642 5* 03QuantumV 5* (+80) 10add chromacode > 1736255566 790216 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149640&oldid=149545 5* 03QuantumV 5* (+89) 10add chromacode > 1736255795 822750 PRIVMSG #esolangs :14[[07ChromaCode14]]4 10 02https://esolangs.org/w/index.php?diff=149641&oldid=149636 5* 03QuantumV 5* (+213) 10better description < 1736259193 376496 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname > 1736260170 661770 PRIVMSG #esolangs :14[[07fuck14]]4 10 02https://esolangs.org/w/index.php?diff=149642&oldid=133904 5* 03None1 5* (-1) 10/* Induct */ > 1736260663 124619 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149643&oldid=149378 5* 03None1 5* (+151) 10/* Cat program */ > 1736260730 954610 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149644&oldid=149643 5* 03None1 5* (+4) 10/* Overview */ > 1736261134 674269 PRIVMSG #esolangs :14[[07TMMLPTEALPAITAFNFAL14]]4 10 02https://esolangs.org/w/index.php?diff=149645&oldid=110906 5* 03Win7HE 5* (+11) 10/* External resources */ > 1736261375 552104 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149646&oldid=149621 5* 03Ractangle 5* (+484) 10 > 1736261550 114736 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149647&oldid=149646 5* 03Ractangle 5* (+37) 10/* Syntax */ < 1736264438 241729 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736264541 516936 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :`olist 1316 < 1736264545 450782 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :olist : shachaf oerjan Sgeo boily nortti b_jonas Noisytoot < 1736264980 462025 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds > 1736265562 232207 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149648&oldid=147453 5* 03Win7HE 5* (+138) 10/* Original Command */ > 1736265591 136942 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149649&oldid=149648 5* 03Win7HE 5* (-138) 10/* Original Command */ > 1736265659 756938 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149650&oldid=149649 5* 03Win7HE 5* (+176) 10/* Additions */ > 1736265693 656690 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149651&oldid=149650 5* 03Win7HE 5* (+3) 10/* 99 bottles of beers */ > 1736265813 210397 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149652&oldid=149651 5* 03Win7HE 5* (+18) 10 < 1736265883 287797 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736265902 941275 PRIVMSG #esolangs :14[[07Talk:Dir14]]4 N10 02https://esolangs.org/w/index.php?oldid=149653 5* 03Juanp32 5* (+275) 10bro. if you dont put any info on an esolang besides "i made this" then dont make the page at all. it makes no sense. at least write some basic documentation in the page > 1736266175 612739 PRIVMSG #esolangs :14[[07Talk:2025!14]]4 N10 02https://esolangs.org/w/index.php?oldid=149654 5* 03Win7HE 5* (+117) 10Created page with "swhrenndid you create this esyoolang --~~~~" < 1736266289 897524 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) < 1736266341 728884 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust < 1736266342 49364 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--) < 1736266390 323218 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust < 1736266390 508268 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--) < 1736266407 948347 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :now beats every other program but is still in second place :-) < 1736266529 272240 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust backstop2 < < 1736266529 399043 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.backstop2: points -46.00, score 0.00, rank 47/47 (-46) < 1736266546 685231 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust backstop2 http://nethack4.org/pastebin/backstop2.bfjoust < 1736266547 14039 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.backstop2: points 22.62, score 61.20, rank 1/47 (+46) > 1736266593 266974 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149655&oldid=149280 5* 03Calculus is fun 5* (+778) 10Added more examples related to repeat. > 1736266868 945505 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149656&oldid=149655 5* 03Calculus is fun 5* (-2) 10word change > 1736267009 317264 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149657&oldid=149615 5* 03Ais523 5* (+280) 10/* Please ban User:ZCX islptng. */ that doesn't need a ban < 1736267438 876903 :int-e!~noone@int-e.eu PRIVMSG #esolangs :"ntroduction to Prolog: A Programming Language for AI" < 1736267442 15160 :int-e!~noone@int-e.eu PRIVMSG #esolangs :...right < 1736267449 55708 :int-e!~noone@int-e.eu PRIVMSG #esolangs :+I < 1736267493 270262 :int-e!~noone@int-e.eu PRIVMSG #esolangs :https://prologyear.logicprogramming.org/ may be a factor too < 1736267623 789444 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i mean, that kinda was the case back when "ai" wasn27 < 1736267633 101011 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :wasnt a buzzword for gpt < 1736267655 769783 :int-e!~noone@int-e.eu PRIVMSG #esolangs :or neural networks < 1736267683 239958 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :or that, yes < 1736267686 230044 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I associate this with early AI efforts... expert systems. < 1736267697 742099 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :but for querying knowledge databases in prolog is great < 1736267708 565646 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i would love for curry to be more mainstream, though < 1736267714 730837 :int-e!~noone@int-e.eu PRIVMSG #esolangs :but that article is from 2022 ;) < 1736267738 427123 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Or 2023. Link: https://builtin.com/software-engineering-perspectives/prolog < 1736267752 785438 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :thats kinda late to the party < 1736267844 430417 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Oh it has an "Example AI Application of Prolog" < 1736267862 730476 :int-e!~noone@int-e.eu PRIVMSG #esolangs :scary < 1736267933 529896 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :incredible artificial intelligence at work < 1736267934 949069 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(yes, medical diagnoses are all black or white and Prolog is the perfect tool for *achoo* that) > 1736268257 893322 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149658&oldid=149099 5* 03Ais523 5* (+3990) 10/* 2025 */ add ais523.two_thirds > 1736268307 225311 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 M10 02https://esolangs.org/w/index.php?diff=149659&oldid=149658 5* 03Ais523 5* (-1) 10/* 2025 */ grammar < 1736268582 899577 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :!zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust < 1736268583 162282 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :ais523.two_thirds: points 18.83, score 50.17, rank 2/47 (--) < 1736268619 434171 :myname!~myname@v2202404221793264578.bestsrv.de PRIVMSG #esolangs :i recently learned about lean and i am somewhat excited about that > 1736268761 954783 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149660&oldid=149659 5* 03Ais523 5* (+106) 10/* 2025 */ mention the 3-cycle clear; also fix the explanation of the fast rush (the program was buggy and was also fixed to match the explanation, improving its score slightly) > 1736268812 201277 PRIVMSG #esolangs :14[[07Talk:2025!14]]4 10 02https://esolangs.org/w/index.php?diff=149661&oldid=149654 5* 03Aadenboy 5* (+384) 10 > 1736268919 229155 PRIVMSG #esolangs :14[[07!@$%^&*()+14]]4 M10 02https://esolangs.org/w/index.php?diff=149662&oldid=144952 5* 03Aadenboy 5* (-1) 10 > 1736269037 978531 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149663&oldid=149660 5* 03Ais523 5* (+449) 10/* 2025 */ mention the trail innovation < 1736269076 840103 :int-e!~noone@int-e.eu PRIVMSG #esolangs :What a great hotkey you picked there, Twitch... alt-T would never do anything in a browser. (Firefox has a _T_ools menu) > 1736270932 956572 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149664&oldid=149595 5* 03Galvandi 5* (+391) 10/* Introductions */ > 1736271132 634173 PRIVMSG #esolangs :14[[07User:Galvandi/Sandbox14]]4 N10 02https://esolangs.org/w/index.php?oldid=149665 5* 03Galvandi 5* (+4) 10Created page with "Test" < 1736272875 320781 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736273252 540526 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :int-e: see that's your mistake, yer supposed to use a dedicated browser for it (well, in the form of electron) < 1736273286 483495 :int-e!~noone@int-e.eu PRIVMSG #esolangs :electron, my arch-nemesis < 1736273332 605495 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(unrelated... but there's so many games that use electron but only provide windows and macos executables and wine chokes on electron apps) < 1736273372 143331 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(the irony of electron being supposedly portable is not lost on me) < 1736273778 185959 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736274290 868414 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 272 seconds < 1736274449 938560 :FireFly!~firefly@glowbum/gluehwuermchen/firefly PRIVMSG #esolangs :I wonder how hard it would be to write something to "convert" such an executable to something that can be readily run.. I guess the tricky part would be dependencies on dll's and similar < 1736274758 506165 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736274814 483167 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds < 1736274934 325750 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life > 1736274953 562590 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:Dominoscript-logo.png10]]" > 1736275172 162425 PRIVMSG #esolangs :14[[07Factorial14]]4 10 02https://esolangs.org/w/index.php?diff=149667&oldid=149639 5* 03Jan jelo 5* (+197) 10/* Implementations */ > 1736275231 721029 PRIVMSG #esolangs :14[[07Recs14]]4 10 02https://esolangs.org/w/index.php?diff=149668&oldid=148410 5* 03Jan jelo 5* (+3) 10/* Example */ < 1736276770 798850 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I think there are better ways to make portable programs anyways < 1736276782 797345 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Although, it also depends on what you expect the program to do) > 1736277005 555764 PRIVMSG #esolangs :14[[07WhatLang14]]4 10 02https://esolangs.org/w/index.php?diff=149669&oldid=148686 5* 03Jan jelo 5* (+149) 10/* Example programs */ < 1736277087 210542 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736277339 205191 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript noop code visual representation .png10]]" > 1736277573 924979 PRIVMSG #esolangs :14[[07WhatLang14]]4 M10 02https://esolangs.org/w/index.php?diff=149671&oldid=149669 5* 03Jan jelo 5* (-6) 10/* Example programs */ > 1736278070 181803 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149672&oldid=149647 5* 0347 5* (+39) 10/* Implementation */ > 1736278983 174504 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149673&oldid=149672 5* 0347 5* (+19) 10/* Syntax */ < 1736279321 185956 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Read error: Connection reset by peer < 1736279336 266505 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse > 1736280268 180357 PRIVMSG #esolangs :14[[07User:RocketRace14]]4 10 02https://esolangs.org/w/index.php?diff=149674&oldid=148585 5* 03RocketRace 5* (-52) 10 > 1736280589 996172 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-003-flow.png10]]" < 1736285246 112428 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736285814 998531 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736286443 539380 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149676&oldid=149585 5* 03Ractangle 5* (-14) 10/* Stuff to continue */ > 1736286504 623377 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149677&oldid=149337 5* 03Ractangle 5* (+24) 10/* Esolangs */ > 1736286584 597751 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149678&oldid=149673 5* 03Ractangle 5* (+52) 10/* Examples */ > 1736286749 667407 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149679&oldid=149640 5* 03Ractangle 5* (+43) 10/* Malbolge Unshackled */ < 1736287079 695909 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736288796 128406 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Ping timeout: 264 seconds < 1736288834 20693 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse > 1736289519 855286 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149680&oldid=149656 5* 03Calculus is fun 5* (+308) 10Restructuring > 1736290734 716811 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149681&oldid=149652 5* 03Juanp32 5* (+287) 10/* Additions */ > 1736290943 10677 PRIVMSG #esolangs :14[[07Free Esolang14]]4 10 02https://esolangs.org/w/index.php?diff=149682&oldid=149681 5* 03Juanp32 5* (+53) 10/* Programs */ > 1736291002 781465 PRIVMSG #esolangs :14[[07Free Esolang14]]4 M10 02https://esolangs.org/w/index.php?diff=149683&oldid=149682 5* 03Juanp32 5* (+13) 10ooooops forgot a tag < 1736292791 66041 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736293263 253464 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname < 1736294547 253486 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds < 1736294703 839289 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736297637 432689 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 N10 02https://esolangs.org/w/index.php?oldid=149684 5* 03PkmnQ 5* (+1103) 10Created page with "The [[Kolakoski sequence]] is a sequence of 1's and 2's such that if you take the lengths of each run of the sequence, the result is the same as the original sequence. There are actually two sequences that fit this definition with their only difference being a > 1736300542 729214 PRIVMSG #esolangs :14[[07Tiny14]]4 M10 02https://esolangs.org/w/index.php?diff=149685&oldid=108815 5* 03Ron.hudson 5* (+63) 10Add github page < 1736301426 36417 :int-e!~noone@int-e.eu PRIVMSG #esolangs :@oeis 1,2,4,8,16,31 < 1736301426 402077 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs : Sequence not found. < 1736301439 132900 :int-e!~noone@int-e.eu PRIVMSG #esolangs :ACTION wonders how long *that* has been broken < 1736301496 673220 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(for a stupid reason too; http://oeis.org/search forcefully redirects to HTTPS) < 1736301946 616283 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :@metar EGBB < 1736301946 830485 :lambdabot!~lambdabot@haskell/bot/lambdabot PRIVMSG #esolangs :Request failed. < 1736302473 138290 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Yeah I know that one broke too. < 1736302938 739888 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Wow that API endpoint is completely different now. < 1736302957 60219 :int-e!~noone@int-e.eu PRIVMSG #esolangs :And also does the mandatory HTTPS thing which is annoying. < 1736303770 988178 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement < 1736304284 289504 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :Unfortunately many servers have mandatory HTTPS and I think that they shouldn't do that (but they won't believe me, I think). > 1736304309 159280 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNumerals.png10]]": numerals zero through nine < 1736304328 911837 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(Gemini protocol has only TLS, and some others that some people had make up also decide the same thing, even though I think that is no good. I wrote Scorpion protocol to specify that a server is not supposed to have mandatory TLS (except files that require a client certificate to access).) < 1736304383 849185 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Hm. So, sorry if I'm repeating myself. (Brain damage is a literary device, etc.) There are several standard problems on the wiki which are well-known enough to serve as general-purpose comparison points: truth machine, quine, etc. Do we have an embarassingly-parallel problem? < 1736304419 337928 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I don't know, but perhaps they should have < 1736304443 757121 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :The idea would be to hack out something like a Mandelbrot set to show off parallelism in a language or toolkit. Mandelbrot might not be the best because it's graphical, chaotic, and possibly too expensive. > 1736304485 178644 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNumerals.png10]]": padding fix > 1736307573 920361 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNop.png10]]": small square > 1736307607 535800 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInput.png10]]": downward half-barbed arrow > 1736307626 838524 PRIVMSG #esolangs :14[[07User:Aadenboy/Draft14]]4 N10 02https://esolangs.org/w/index.php?oldid=149690 5* 03Aadenboy 5* (+2533) 10[[Kawa]] draft < 1736307779 100190 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :korvo: FizzBuzz is almost embarassingly parallel, apart from the I/O < 1736307803 264340 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :but in general I'd expect such programs to parallelize well only by chance as the people who create them probably have single-threaded imperative languages in mind < 1736307876 396505 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :ais523: That's not terrible, although yeah, the I/O's kind of important since it has to be serialized correctly. < 1736307967 973001 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Concretely, suppose I want to show off how Cello makes C threading and mutexes easy. I was going to do something like write a little FIFO queue, put the pixels into the queue or maybe write an iterator for it, and then have a threadpool which consumes the pixels. < 1736307974 806293 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But that sounds like a lot of code for a little wiki demo. < 1736309491 683743 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I guess a good simple demo would be to map a function over a large range of integers and sum the results, although I'm not sure offhand what functions would be easy to implement and yet not allow you to get the sum into closed form < 1736309495 419356 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :anyway, I should go to bed < 1736309502 5334 :ais523!~ais523@user/ais523 QUIT :Quit: quit < 1736312734 376331 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam < 1736321138 621599 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :perlbot oeis 1,2,4,8,16,31 < 1736321139 222841 :perlbot!~perlbot@perlbot/bot/simcop2387/perlbot PRIVMSG #esolangs :b_jonas: http://oeis.org/searchs?q=1%2C2%2C4%2C8%2C16%2C31 A102726(1/72) Number of compositions of the integer n into positive parts that avoid a fixed pattern of three letters.: 1,1,2,4,8,16,31,60,114,214,398,732,1334,2410,4321,7688,13590,23869,41686,72405,125144,215286,368778,629156,1069396,1811336,3058130,5147484,8639976,14463901,24154348,40244877,669115... [Output truncated. http://perl.bot/p/5eyflq ] < 1736321141 725476 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :int-e: ^ < 1736321188 606538 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :though for this search there are lots of hits so you'll need more terms > 1736322245 734076 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-Factorial-flow.png10]]" < 1736322368 653823 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer > 1736322650 741838 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Galvandi 5* 10uploaded "[[02File:DominoScript-Example-WASD-Input-Example-Flow.png10]]" < 1736323498 144966 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity < 1736323719 940486 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736326910 886143 PRIVMSG #esolangs :14[[07DominoScript14]]4 N10 02https://esolangs.org/w/index.php?oldid=149693 5* 03Galvandi 5* (+7719) 10initial dominoscript documentation < 1736326987 477353 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname > 1736327210 764986 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149694&oldid=149693 5* 03Galvandi 5* (+9487) 10Adding new sections > 1736327350 873470 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149695&oldid=149694 5* 03Galvandi 5* (+30788) 10Added section about instructions > 1736327447 796282 PRIVMSG #esolangs :14[[07DominoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149696&oldid=149695 5* 03Galvandi 5* (+15827) 10Added section about NavigatioModes & Examples > 1736327946 381197 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149697&oldid=149638 5* 03Galvandi 5* (+19) 10Added DominoScript to the list > 1736328075 181285 PRIVMSG #esolangs :14[[07User:Galvandi14]]4 N10 02https://esolangs.org/w/index.php?oldid=149698 5* 03Galvandi 5* (+63) 10Initial my user page < 1736332407 296160 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736332657 462184 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736333034 74429 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736334133 536585 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=149699&oldid=149684 5* 03None1 5* (+1004) 10/* Examples */ add brainfuck > 1736334512 878998 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=149700&oldid=149699 5* 03None1 5* (+156) 10/* brainfuck */ < 1736334671 104574 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname > 1736337277 408779 PRIVMSG #esolangs :14[[07User:I am islptng/Template:Signature14]]4 10 02https://esolangs.org/w/index.php?diff=149701&oldid=149608 5* 03I am islptng 5* (+478) 10 < 1736337771 434809 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 246 seconds < 1736337907 77366 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1736339330 374732 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736339601 922838 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149702&oldid=149549 5* 03None1 5* (+67) 10/* My Esolangs */ > 1736339723 377664 PRIVMSG #esolangs :14[[07User:None114]]4 M10 02https://esolangs.org/w/index.php?diff=149703&oldid=149702 5* 03None1 5* (+0) 10/* My Esolangs */ Oh I almost forgot < 1736339973 279267 :APic!apic@apic.name PRIVMSG #esolangs :Hi > 1736340614 987001 PRIVMSG #esolangs :14[[07Whole14]]4 N10 02https://esolangs.org/w/index.php?oldid=149704 5* 03None1 5* (+375) 10Created page with "'''Whole''' is an esolang invented by [[User:None1]]. It is a version of [[]] that uses English letters. ==Commands==
 Whole      Corresponding word _______________________________ h          hole q          question e          exclamation w          warning 
==E > 1736340733 286834 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149705&oldid=149704 5* 03None1 5* (+107) 10 > 1736340781 696957 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149706&oldid=111983 5* 03None1 5* (+26) 10/* Example Programs */ > 1736340809 402623 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=149707&oldid=149706 5* 03None1 5* (-2) 10/* See also */ > 1736341506 855428 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149708&oldid=149705 5* 03None1 5* (+306) 10 > 1736341640 38968 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149709&oldid=149708 5* 03None1 5* (+2) 10/* Variants */ not i > 1736341845 489011 PRIVMSG #esolangs :14[[07Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149710&oldid=149709 5* 03None1 5* (+87) 10/* Examples */ > 1736342121 473838 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=149711&oldid=147971 5* 03None1 5* (+53) 10/* General languages */ > 1736342172 226729 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=149712&oldid=149703 5* 03None1 5* (+54) 10/* My Esolangs */ > 1736342314 25162 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149713&oldid=149349 5* 03None1 5* (+362) 10 > 1736342475 535270 PRIVMSG #esolangs :14[[07!I!M!P!O!S!S!I!B!L!E!14]]4 10 02https://esolangs.org/w/index.php?diff=149714&oldid=108657 5* 03None1 5* (+15) 10 > 1736342565 255833 PRIVMSG #esolangs :14[[07Template:Infobox proglang14]]4 10 02https://esolangs.org/w/index.php?diff=149715&oldid=126878 5* 03None1 5* (+25) 10 > 1736342593 791883 PRIVMSG #esolangs :14[[07!I!M!P!O!S!S!I!B!L!E!14]]4 M10 02https://esolangs.org/w/index.php?diff=149716&oldid=149714 5* 03None1 5* (-15) 10 > 1736342738 196578 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149717&oldid=149707 5* 03None1 5* (+18) 10/* See also */ add year < 1736343661 7611 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736345299 439918 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ZachChecksOutEsolangs 5* 10uploaded "[[02File:OK FINE!!!.png10]]": The logo for the "OK FINE!!!" esolang > 1736345973 860435 PRIVMSG #esolangs :14[[07Talk:Whole14]]4 N10 02https://esolangs.org/w/index.php?oldid=149719 5* 03I am islptng 5* (+597) 10Created page with "I think you misspelled the title. whole adj. hole n. ~~~~" > 1736346462 302203 PRIVMSG #esolangs :14[[07^14]]4 10 02https://esolangs.org/w/index.php?diff=149720&oldid=139345 5* 03I am islptng 5* (+114) 10 < 1736346669 33479 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736346684 612549 PRIVMSG #esolangs :14[[07^Romn14]]4 N10 02https://esolangs.org/w/index.php?oldid=149721 5* 03I am islptng 5* (+1723) 10Created page with "{| class="wikitable" |+ Commands |- ! Romanian !! English !! Meaning |- | Spune "[text]" || Print "[text]" || Prints a string of text |- | Spune [variabilul] || Output [variable] || Outputs the value of a variable |- | Ia [variabilul] || Input [variable] / Enter [var > 1736346831 944096 PRIVMSG #esolangs :14[[07Talk:^Romn14]]4 N10 02https://esolangs.org/w/index.php?oldid=149722 5* 03I am islptng 5* (+597) 10Created page with "[[^]]~~~~" < 1736346931 198100 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT : > 1736347143 694767 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149723&oldid=149657 5* 03I am islptng 5* (+93) 10/* Please ban User:ZCX islptng. */ > 1736347532 135299 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149724&oldid=149723 5* 03Ais523 5* (+238) 10/* Please ban User:ZCX islptng. */ MediaWiki isn't designed to replace old links to userpages > 1736347672 925707 PRIVMSG #esolangs :14[[07User talk:Ais523/Archive214]]4 N10 02https://esolangs.org/w/index.php?oldid=149725 5* 03Ais523 5* (+61405) 10archiving my talk page > 1736347680 716240 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149726&oldid=149724 5* 03Ais523 5* (-61373) 10archiving > 1736348914 762559 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149727&oldid=149726 5* 03I am islptng 5* (+88) 10/* Please ban User:ZCX islptng. */ < 1736350361 77626 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull > 1736350915 483530 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149728&oldid=149592 5* 03Juanp32 5* (+124) 10/* Commands */ > 1736350999 676591 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149729&oldid=149728 5* 03Juanp32 5* (+0) 10TYPO ARGH < 1736351433 788281 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736351822 976029 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149730&oldid=149727 5* 03Aadenboy 5* (+369) 10/* Please ban User:ZCX islptng. */ < 1736351867 644667 :citrons!~citrons@alt.mondecitronne.com QUIT :Ping timeout: 244 seconds > 1736351988 165602 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNumerals.png10]]": add background > 1736352018 103026 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaNop.png10]]": add background > 1736352039 825721 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5* 10uploaded a new version of "[[02File:KawaInput.png10]]": add background > 1736352145 419332 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutput.png10]]": upward right-barbed arrow < 1736352224 509973 :citrons!~citrons@alt.mondecitronne.com JOIN #esolangs citrons :citrons > 1736352224 735104 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaConditionals.png10]]": slanted line with bisecting horizontal segment > 1736352329 582010 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaJumps.png10]]": 45 angle with vertical segment underneath < 1736352783 410774 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736355027 478423 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierWithTwo.png10]]": left bar diacritic > 1736355054 173534 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierLimit.png10]]": top bar diacritic > 1736355075 916424 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierAsOne.png10]]": right bar diacritic > 1736355097 887168 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierNegate.png10]]": bottom bar diacritic > 1736355979 444729 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149741&oldid=149663 5* 03Ais523 5* (-16) 10/* 2025 */ clarify > 1736356066 509526 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=149742&oldid=149741 5* 03Ais523 5* (+0) 10/* 2025 */ fix an incorrect word > 1736356652 585456 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaModifierSequentially.png10]]": left downward-barbed arrow > 1736358346 252936 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03AdjectiveNounNumber 5* 10New user account > 1736359410 677347 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149744&oldid=149664 5* 03AdjectiveNounNumber 5* (+181) 10 > 1736359445 217352 PRIVMSG #esolangs :14[[07User talk:AdjectiveNounNumber14]]4 N10 02https://esolangs.org/w/index.php?oldid=149745 5* 03AdjectiveNounNumber 5* (+1) 10Created page with "e" < 1736360798 872241 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736360859 983903 :APic!apic@apic.name PRIVMSG #esolangs :cu > 1736360967 465432 PRIVMSG #esolangs :14[[07Convert14]]4 N10 02https://esolangs.org/w/index.php?oldid=149746 5* 03AdjectiveNounNumber 5* (+28) 10Created page with "{{wrongtitle|title=->}} WIP" < 1736361190 130234 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736361297 558176 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds < 1736361297 654806 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life < 1736362410 234752 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam > 1736362761 745792 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149747&oldid=149746 5* 03AdjectiveNounNumber 5* (+752) 10 < 1736363116 989287 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736363241 573612 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalse10]] to [[Befalse (Ian Osgood)]]: thought of making a language with the same name so... > 1736363269 306136 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02TIB-472 Calculator10]] to [[Befalse (Ractangle)]] > 1736363419 358343 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149752&oldid=149750 5* 0347 5* (-277) 10will come up with syntax later > 1736363575 860523 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopConcatenate.png10]]": nop + with two > 1736363592 617505 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopAbsoluteValue.png10]]": nop + limit > 1736363614 633242 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopBooleanify.png10]]": nop + as one > 1736363629 240860 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopNegate.png10]]": nop + negate > 1736363651 206541 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopModulo.png10]]": nop + with two + limit > 1736363684 461637 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopAdd.png10]]": nop + with two + as one > 1736363705 137821 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSplit.png10]]": nop + with two + negate > 1736363770 369893 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopFirstDigit.png10]]": nop + limit + as one > 1736363800 197996 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopRound.png10]]": nop + limit + negate > 1736363817 604273 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSign.png10]]": nop + as one + negate > 1736363854 379103 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopMaximum.png10]]": nop + with two + limit + as one > 1736363862 275312 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149764&oldid=149752 5* 0347 5* (+280) 10 > 1736363886 463038 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopDivide.png10]]": nop + with two + as one + negate > 1736363909 970471 PRIVMSG #esolangs :14[[07File:KawaNopDivide.png14]]4 M10 02https://esolangs.org/w/index.php?diff=149766&oldid=149765 5* 03Aadenboy 5* (-1) 10/* Summary */ wrong > 1736363936 15198 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopSubtract.png10]]": nop + with two + as one + negate > 1736363960 437357 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopLastDigit.png10]]": nop + limit + as one + negate > 1736363987 896504 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaNopMinimum.png10]]": nop + with two + limit + as one + negate > 1736364635 5273 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149770&oldid=149764 5* 0347 5* (-58) 10/* Commands */ > 1736364650 158883 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149771&oldid=149770 5* 0347 5* (-12) 10/* Commands */ > 1736364795 232823 PRIVMSG #esolangs :14[[07Befalse (Ractangle)14]]4 10 02https://esolangs.org/w/index.php?diff=149772&oldid=149771 5* 0347 5* (+28) 10/* Commands */ > 1736366285 532737 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149773&oldid=149676 5* 0347 5* (-11) 10/* Stuff to continue */ > 1736366313 187899 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move_redir10 02 5* 0347 5* 10moved [[02Befalse (Ian Osgood)10]] to [[Befalse]] over redirect > 1736366313 202497 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete_redir10 02 5* 0347 5* 1047 deleted redirect [[02Befalse10]] by overwriting: Deleted to make way for move from "[[Befalse (Ian Osgood)]]" > 1736366341 19070 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalse (Ractangle)10]] to [[Befalsia]] > 1736366370 44908 PRIVMSG #esolangs :14[[07Befalsia14]]4 10 02https://esolangs.org/w/index.php?diff=149778&oldid=149776 5* 0347 5* (-6) 10 < 1736366435 504993 :visilii_!~visilii@188.254.110.9 JOIN #esolangs * :ZNC - https://znc.in > 1736366636 805716 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149779&oldid=149747 5* 03AdjectiveNounNumber 5* (+116) 10 < 1736366680 73437 :visilii!~visilii@213.24.125.237 QUIT :Ping timeout: 265 seconds > 1736367260 508141 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149780&oldid=149779 5* 03AdjectiveNounNumber 5* (+93) 10 < 1736367358 62898 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736367471 772879 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736367519 227218 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149781&oldid=149780 5* 03AdjectiveNounNumber 5* (-28) 10 > 1736367551 488854 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149782&oldid=149781 5* 03AdjectiveNounNumber 5* (-3) 10 > 1736367612 430799 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149783&oldid=149782 5* 03AdjectiveNounNumber 5* (+45) 10 > 1736368516 443542 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149784&oldid=149680 5* 03Calculus is fun 5* (+1835) 10Added Input and output > 1736368622 349793 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149785&oldid=149784 5* 03Calculus is fun 5* (-12) 10/* IO & strings */ < 1736369034 603282 :craigo!~craigo@user/craigo QUIT :Quit: Leaving > 1736369058 360010 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149786&oldid=149785 5* 03Calculus is fun 5* (+239) 10/* Behavior */ > 1736369173 163481 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149787&oldid=149786 5* 03Calculus is fun 5* (+2) 10moved 99bobotw example > 1736369590 572267 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03AceDoesStuff 5* 10New user account < 1736369603 695131 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736371825 477618 PRIVMSG #esolangs :14[[07Uhidklol14]]4 10 02https://esolangs.org/w/index.php?diff=149788&oldid=149526 5* 03Juanp32 5* (+32) 10/* instructions */ added `q` command (which is shamelessly stolen off ed(1) lol) > 1736372018 423396 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputWithTwo.png10]]": input + with two > 1736372042 369992 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputLimit.png10]]": input + limit > 1736372068 932093 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputLimitSequentially.png10]]": input + limit + sequentially < 1736373088 267552 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736373776 3818 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity < 1736374079 743372 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736377342 995686 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149792&oldid=149787 5* 03Calculus is fun 5* (+205) 10Added a cat *meow* > 1736377468 795992 PRIVMSG #esolangs :14[[07Talk:Whole14]]4 10 02https://esolangs.org/w/index.php?diff=149793&oldid=149719 5* 03None1 5* (+396) 10 < 1736378285 919242 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736380977 99121 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds < 1736381066 441009 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname < 1736381189 969408 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736382793 398405 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149794&oldid=119744 5* 03Kaveh Yousefi 5* (+12) 10Rectified a few logical errors in the example programs 99 bottles of beer and Factorial, as well as an aesthetical blemish in the FizzBuzz example. > 1736382904 914837 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149795&oldid=149794 5* 03Kaveh Yousefi 5* (+199) 10Added a hyperlink to my implementation of the Meow programming language on GitHub and supplemented the Implemented category tag. > 1736383345 758650 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaInputAsOne.png10]]": input + as one > 1736383356 458860 PRIVMSG #esolangs :14[[07Meow (Martsadas)14]]4 10 02https://esolangs.org/w/index.php?diff=149797&oldid=149795 5* 03Kaveh Yousefi 5* (+208) 10Supplemented references to the register names in the instruction table and reformatted operations as code fragments. > 1736383364 965507 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaLimitNegate.png10]]": kawa + limit + negate > 1736383393 435804 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputWithTwo.png10]]": output + with two > 1736383424 634755 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputLimitAsOne.png10]]": output + limit + as one > 1736383442 545143 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputAsOne.png10]]": output + as one > 1736383463 941136 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputNegate.png10]]": output + negate > 1736383485 446727 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaOutputSequentially.png10]]": output + sequentially > 1736383506 242276 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfWithTwo.png10]]": if + with two > 1736383525 73599 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfLimit.png10]]": if + limit > 1736383541 195217 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfNegate.png10]]": if + negate > 1736383568 349313 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentially.png10]]": if + sequentially > 1736383589 214578 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentiallyAsOne.png10]]": if + sequentially + as one > 1736383611 473478 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaIfSequentiallyWithTwo.png10]]": if + sequentially + with two < 1736385762 82717 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 265 seconds < 1736385848 520628 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k > 1736386212 237514 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticSequentially.png10]]": left downward-barbed arrow > 1736386241 425322 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPushTop.png10]]": upward chevron > 1736386261 494319 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPushBottom.png10]]": upward arch > 1736386284 918079 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPopTop.png10]]": downward chevron > 1736386304 320944 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticPopBottom.png10]]": downward arch > 1736386332 677923 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticAsTwo.png10]]": diaeresis > 1736386352 198287 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticDiscard.png10]]": squiggle > 1736386751 925703 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaHelloWorld.png10]]": [[Hello, World!]] in [[Kawa]] < 1736387067 34826 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds < 1736387911 467443 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736387968 492623 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaFibonacci.png10]]": [[Fibonacci sequence]] in [[Kawa]] > 1736387996 509459 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaDiacriticFlag.png10]]": short T > 1736388196 241977 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaTruthMachine.png10]]": [[Truth-machine]] in [[Kawa]] > 1736388228 678131 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaCat.png10]]": [[Cat program]] in [[Kawa]] > 1736388300 278584 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5* 10uploaded "[[02File:KawaJumpBack.png10]]" < 1736390617 424775 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement < 1736391151 928181 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez < 1736391490 187738 :ais523!~ais523@user/ais523 QUIT :Quit: quit > 1736394043 326447 PRIVMSG #esolangs :14[[07Kawa14]]4 N10 02https://esolangs.org/w/index.php?oldid=149823 5* 03Aadenboy 5* (+9826) 10Created page with "{{infobox proglang |name=Kawa |paradigms=? |author=[[User:Aadenboy]] |year=[[:Category:2025|2025]] |memsys=Deque, stack |dimensions=One-dimensional |refimp=[https://github.com/aadenboy/Kawa-IDE aadenboy/Kawa-IDE] |class=[[:Category:Turing complete|Turing complete]] 1736394094 69387 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 10 02https://esolangs.org/w/index.php?diff=149824&oldid=149123 5* 03Aadenboy 5* (+70) 10/* MY ESOLANGS */ add [[Kawa]] > 1736394152 395070 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149825&oldid=149697 5* 03Aadenboy 5* (+11) 10/* K */ add [[Kawa]] > 1736394187 574487 PRIVMSG #esolangs :14[[07Semi-serious language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149826&oldid=148517 5* 03Aadenboy 5* (+11) 10/* K */ add Kawa < 1736394505 564208 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, *that's* why they needed all of those images. > 1736394914 912984 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (H-M)14]]4 M10 02https://esolangs.org/w/index.php?diff=149827&oldid=145778 5* 03Aadenboy 5* (+42) 10add [[Kawa]] > 1736395012 639056 PRIVMSG #esolangs :14[[07Truth-machine14]]4 M10 02https://esolangs.org/w/index.php?diff=149828&oldid=149679 5* 03Aadenboy 5* (+45) 10add [[Kawa]] > 1736395059 892812 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=149829&oldid=149823 5* 03Aadenboy 5* (+31) 10distinguish confusion > 1736395079 51726 PRIVMSG #esolangs :14[[07Kava14]]4 M10 02https://esolangs.org/w/index.php?diff=149830&oldid=141031 5* 03Aadenboy 5* (+31) 10distinguish confusion < 1736396028 43972 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 265 seconds < 1736402555 476229 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname < 1736406534 647103 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1736407443 323202 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736414816 206636 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736415864 461189 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736418264 511733 :APic!apic@apic.name PRIVMSG #esolangs :Hi < 1736419176 266995 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736423308 130799 PRIVMSG #esolangs :14[[07List of quines14]]4 M10 02https://esolangs.org/w/index.php?diff=149831&oldid=149581 5* 03UrnEn 5* (+40) 10 < 1736423402 472275 :__monty__!~toonn@user/toonn QUIT :Ping timeout: 252 seconds < 1736424066 943366 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736424149 210716 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds < 1736424346 33255 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User > 1736424852 375422 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Blashyrkh 5* 10New user account > 1736425163 44531 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149832&oldid=149744 5* 03Blashyrkh 5* (+186) 10/* Introductions */ > 1736426818 638621 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Blashyrkh 5* 10uploaded "[[02File:Fire.png10]]" > 1736427029 450578 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149834&oldid=149259 5* 03Blashyrkh 5* (+222) 10/* Programs */ Fire program uploaded < 1736430057 988140 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname < 1736430235 217610 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736431975 707033 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03ClearLimediWater 5* 10New user account > 1736432739 883652 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149835&oldid=149832 5* 03ClearLimediWater 5* (+207) 10 > 1736433196 329068 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 N10 02https://esolangs.org/w/index.php?oldid=149836 5* 03ClearLimediWater 5* (+21) 10Created page with "" < 1736436979 915047 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1736437597 227168 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149837&oldid=149783 5* 03AdjectiveNounNumber 5* (+12) 10 > 1736437992 211187 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149838&oldid=149837 5* 03AdjectiveNounNumber 5* (+96) 10 < 1736438200 335563 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1736439294 747677 :Everythi1g!~Everythin@static.208.206.21.65.clients.your-server.de JOIN #esolangs * :Everything < 1736439313 576356 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving < 1736439315 671519 :Everythi1g!~Everythin@static.208.206.21.65.clients.your-server.de QUIT :Client Quit < 1736439334 196172 :Everything!~Everythin@static.208.206.21.65.clients.your-server.de JOIN #esolangs Everything :Everything > 1736441879 92432 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149839&oldid=149420 5* 03TheCanon2 5* (+53) 10Added Disan Count > 1736442673 370901 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149840&oldid=149838 5* 03AdjectiveNounNumber 5* (+463) 10 > 1736442750 982527 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149841&oldid=149839 5* 03TheCanon2 5* (+10) 10When an even number is run through Disan Count, the output doesn't include the input itself. > 1736442886 405615 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149842&oldid=149840 5* 03AdjectiveNounNumber 5* (-32) 10 > 1736443137 667703 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149843&oldid=149828 5* 03AdjectiveNounNumber 5* (+103) 10 > 1736443283 116195 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149844&oldid=149843 5* 03AdjectiveNounNumber 5* (+6) 10 > 1736443303 373149 PRIVMSG #esolangs :14[[07Truth-machine14]]4 10 02https://esolangs.org/w/index.php?diff=149845&oldid=149844 5* 03AdjectiveNounNumber 5* (-1) 10/* -> */ < 1736443861 753085 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736443890 305327 :int-e!~noone@int-e.eu PRIVMSG #esolangs :`? procrastination < 1736443895 968085 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :The Procrastination is destined to rule the world... right after watching this final funny cat clip on youtube. > 1736443941 360948 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149846&oldid=149842 5* 03AdjectiveNounNumber 5* (+29) 10 > 1736444598 774060 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149847&oldid=149846 5* 03AdjectiveNounNumber 5* (+26) 10 > 1736444723 979658 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=149848&oldid=149172 5* 03TheCanon2 5* (+53) 10 < 1736445656 419277 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736445753 866169 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149849&oldid=149847 5* 03AdjectiveNounNumber 5* (+0) 10/* Syntax */ > 1736445783 614526 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149850&oldid=149849 5* 03AdjectiveNounNumber 5* (-88) 10 > 1736446072 623389 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149851&oldid=149850 5* 03AdjectiveNounNumber 5* (+191) 10 < 1736446459 859084 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736447048 93668 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736447328 391951 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736447643 678756 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736447701 127741 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds < 1736447727 330617 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life > 1736447830 708394 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149852&oldid=149851 5* 03AdjectiveNounNumber 5* (+265) 10/* -> */ > 1736447847 339834 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149853&oldid=149852 5* 03AdjectiveNounNumber 5* (+2) 10/* Examples */ > 1736447861 478619 PRIVMSG #esolangs :14[[07Disan Count (language)14]]4 N10 02https://esolangs.org/w/index.php?oldid=149854 5* 03TheCanon2 5* (+431) 10Created page with "'''Disan Count''' is an esoteric programming language created by [[User:TheCanon2]] to demonstrate the insufficiency of using the [[Disan Count]] as a proof for Turing-completeness. ==Commands== Disan Count has 1 register and 2 commands. {|class="wikita > 1736448365 815858 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149855&oldid=149853 5* 03AdjectiveNounNumber 5* (+202) 10/* Syntax */ > 1736448741 907139 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149856&oldid=149855 5* 03AdjectiveNounNumber 5* (+106) 10 < 1736449388 423316 :craigo!~craigo@user/craigo QUIT :Quit: Leaving < 1736449699 35354 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :Ping timeout: 252 seconds < 1736449997 170880 :visilii!~visilii@188.254.110.9 JOIN #esolangs * :ZNC - https://znc.in < 1736450000 534136 :visilii_!~visilii@188.254.110.9 QUIT :Ping timeout: 252 seconds > 1736450083 403514 PRIVMSG #esolangs :14[[07Disan Count (language)14]]4 M10 02https://esolangs.org/w/index.php?diff=149857&oldid=149854 5* 03TheCanon2 5* (+857) 10 < 1736450919 538846 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736452090 439950 PRIVMSG #esolangs :14[[07Talk:Pistons & Pistons14]]4 10 02https://esolangs.org/w/index.php?diff=149858&oldid=79280 5* 03Jan jelo 5* (+172) 10/* Validity? */ > 1736455841 254098 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=149859&oldid=149058 5* 03Ractangle 5* (+0) 10/* Commands */ > 1736455889 226345 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=149860&oldid=149859 5* 03Ractangle 5* (+0) 10/* Examples */ < 1736456569 326549 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode > 1736458046 833382 PRIVMSG #esolangs :14[[07Talk:Convert14]]4 N10 02https://esolangs.org/w/index.php?oldid=149861 5* 03AdjectiveNounNumber 5* (+1) 10Created page with "e" > 1736458518 387787 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149862&oldid=149773 5* 03Ractangle 5* (+1) 10/* Stuff to continue */ > 1736459555 446865 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149863&oldid=149834 5* 03Blashyrkh 5* (+64) 10/* Programs */ Add link to fire.BytePusher's source code > 1736459628 773216 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=149864&oldid=149829 5* 03Aadenboy 5* (+188) 10/* With If */ < 1736459826 355056 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo < 1736461421 865957 :Everything!~Everythin@static.208.206.21.65.clients.your-server.de QUIT :Quit: leaving < 1736461857 16538 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736461889 771264 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit < 1736462229 411074 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736462612 89238 :FreeFull!~freefull@eox236.neoplus.adsl.tpnet.pl QUIT :Ping timeout: 265 seconds < 1736462679 337345 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :Ping timeout: 244 seconds < 1736463365 76466 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo < 1736464887 568270 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736466719 691997 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736467426 92662 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds < 1736467514 418088 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736468570 81440 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149865&oldid=149618 5* 03I am islptng 5* (+75) 10 < 1736472442 895580 :supercode!~supercode@user/supercode QUIT :Quit: Client closed > 1736472557 914714 PRIVMSG #esolangs :14[[07TypeString14]]4 10 02https://esolangs.org/w/index.php?diff=149866&oldid=125431 5* 03GUAqwq 5* (-30) 10/* Turing Complete */ > 1736473683 137917 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03True-grue 5* 10New user account > 1736474467 14803 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149867&oldid=149604 5* 03I am islptng 5* (-5653) 10Goodbye, GaoErFu! < 1736475976 642601 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Excess Flood < 1736475979 232312 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Remote host closed the connection < 1736476046 69936 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ... < 1736476064 434691 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :( < 1736476581 429166 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 246 seconds < 1736476590 58485 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 265 seconds < 1736476599 397226 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :( < 1736476605 415160 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ... < 1736476885 496837 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement > 1736483385 120041 PRIVMSG #esolangs :14[[07Push-up automaton14]]4 N10 02https://esolangs.org/w/index.php?oldid=149868 5* 03BestCoder 5* (+52) 10Created page with "hypothetically the opposite of a push-down automaton" > 1736483564 271551 PRIVMSG #esolangs :14[[07Category talk:Turning tarpits14]]4 10 02https://esolangs.org/w/index.php?diff=149869&oldid=138297 5* 03BestCoder 5* (+60) 10 > 1736483670 496996 PRIVMSG #esolangs :14[[07Talk:Xand14]]4 10 02https://esolangs.org/w/index.php?diff=149870&oldid=129853 5* 03BestCoder 5* (+24) 10 > 1736483684 94158 PRIVMSG #esolangs :14[[07Category:Discussion14]]4 N10 02https://esolangs.org/w/index.php?oldid=149871 5* 03BestCoder 5* (+26) 10Created page with "a category for discussions" > 1736483699 315854 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 N10 02https://esolangs.org/w/index.php?oldid=149872 5* 03BestCoder 5* (+9) 10Created page with "recursion" > 1736483730 198694 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149873&oldid=149872 5* 03BestCoder 5* (+24) 10 > 1736483942 9936 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 N10 02https://esolangs.org/w/index.php?oldid=149874 5* 03Aadenboy 5* (+3402) 10read! fun little idea I had > 1736484014 943796 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=149875&oldid=149824 5* 03Aadenboy 5* (+27) 10/* anything else */ add [[User:Aadenboy/00=0|00=0]] > 1736484118 306215 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149876&oldid=149873 5* 03Aadenboy 5* (+367) 10 > 1736487360 595086 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149877&oldid=149874 5* 03Aadenboy 5* (+86) 10fix > 1736488137 482503 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149878&oldid=149792 5* 03Calculus is fun 5* (+93) 10Edit of intro paragraph. > 1736488427 969347 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149879&oldid=149877 5* 03Aadenboy 5* (+91) 10 > 1736491481 381065 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=149880&oldid=149878 5* 03Calculus is fun 5* (+629) 10Ackermann example < 1736493679 529615 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736494893 74892 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1736498286 951778 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736500568 494200 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736502866 486166 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname < 1736502907 85085 :fowl!~fowl@user/fowl QUIT :Quit: Ping timeout (120 seconds) < 1736502937 170170 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl > 1736506299 318459 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 N10 02https://esolangs.org/w/index.php?oldid=149881 5* 03Calculus is fun 5* (+774) 10Created page with "Hello, I've been programming ever since I was shown Scratch in elementary school, Since then I've jumped between Java, JavaScript, WolframScript, and more, I've seen my fair share of silly programming languages, I made a small library in JS for ratio > 1736506402 11292 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=149882&oldid=149881 5* 03Calculus is fun 5* (-24) 10 > 1736507406 907433 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=149883&oldid=149463 5* 03PrySigneToFry 5* (+247) 10 > 1736507492 446561 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149884&oldid=149713 5* 03PrySigneToFry 5* (+920) 10 > 1736507580 117971 PRIVMSG #esolangs :14[[0714]]4 N10 02https://esolangs.org/w/index.php?oldid=149885 5* 03PrySigneToFry 5* (+84) 10Created page with "{{WIP}} (yuandan) is an programming language that designed by PSTF and None1." > 1736507641 73850 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149886&oldid=149209 5* 03PrySigneToFry 5* (+98) 10/* I've maded the page. */ new section > 1736507652 822370 PRIVMSG #esolangs :14[[07User talk:None114]]4 10 02https://esolangs.org/w/index.php?diff=149887&oldid=149886 5* 03PrySigneToFry 5* (-3) 10/* I've maded the page. */ > 1736508083 522733 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149888&oldid=149880 5* 03Calculus is fun 5* (+268) 10/* Behavior */ > 1736510506 810323 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149889&oldid=149885 5* 03PrySigneToFry 5* (+3667) 10 < 1736510589 568950 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 276 seconds > 1736510681 352396 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149890&oldid=149543 5* 03PrySigneToFry 5* (+478) 10 < 1736510769 435951 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User < 1736511684 678211 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736511759 949393 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736513094 324487 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net JOIN #esolangs * :realname < 1736513140 482077 :craigo!~craigo@user/craigo QUIT :Ping timeout: 252 seconds > 1736513319 827720 PRIVMSG #esolangs :14[[07Cursor14]]4 N10 02https://esolangs.org/w/index.php?oldid=149891 5* 03AdjectiveNounNumber 5* (+640) 10Created page with "Cursor is a 2-dimensional [[Esoteric programming language|esolang]] created by on Jan 10 2025 7:42 ET where you can control propertys of the cursor. (VERY WIP) {| class="wikitable" |+ Component Summarys |- ! Symbol !! Name !! Summary |- | * || Start || Start < 1736515346 312598 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths > 1736517955 273778 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149892&oldid=149835 5* 03True-grue 5* (+141) 10true-grue introduction > 1736517978 806578 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149893&oldid=149890 5* 03None1 5* (+395) 10/* Interpreters */ > 1736518024 669472 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=149894&oldid=149892 5* 03True-grue 5* (+29) 10 > 1736518084 469690 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03True-grue 5* 10uploaded "[[02File:Snow.png10]]" > 1736518151 923468 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149896&oldid=149893 5* 03None1 5* (+419) 10/* Type 16 */ > 1736518600 30736 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03True-grue 5* 10uploaded "[[02File:Small snow.png10]]" > 1736518615 616190 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149898&oldid=149889 5* 03None1 5* (+770) 10 > 1736518636 414907 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149899&oldid=149898 5* 03None1 5* (+29) 10/* Other commands */ > 1736518645 176721 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149900&oldid=149896 5* 03PrySigneToFry 5* (+2401) 10 > 1736518735 345926 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149901&oldid=149900 5* 03PrySigneToFry 5* (+17) 10 > 1736518940 54321 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149902&oldid=149863 5* 03True-grue 5* (+200) 10snowfall simulation < 1736519321 642800 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru JOIN #esolangs * :[https://web.libera.chat] true-grue < 1736519591 123551 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname > 1736520704 447394 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=149903&oldid=149902 5* 03Blashyrkh 5* (+20) 10/* Programs */ < 1736521221 279022 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1736521810 719436 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 N10 02https://esolangs.org/w/index.php?oldid=149904 5* 03Blashyrkh 5* (+75) 10Created page with "It was your article at habr.com that acquainted me with BytePusher. Thanks!" < 1736522003 602814 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru QUIT :Quit: Client closed < 1736522057 641215 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru JOIN #esolangs * :[https://web.libera.chat] true-grue > 1736522366 685160 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149905&oldid=149904 5* 03True-grue 5* (+164) 10 > 1736522376 891779 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149906&oldid=149905 5* 03True-grue 5* (+1) 10 > 1736523384 707110 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149907&oldid=149906 5* 03Blashyrkh 5* (+390) 10 > 1736523421 618251 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149908&oldid=149907 5* 03Blashyrkh 5* (+4) 10 > 1736523576 940143 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149909&oldid=149908 5* 03Blashyrkh 5* (+4) 10 > 1736523806 533826 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149910&oldid=149909 5* 03True-grue 5* (+113) 10 < 1736524813 775075 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736524836 579571 PRIVMSG #esolangs :14[[07User talk:True-grue14]]4 10 02https://esolangs.org/w/index.php?diff=149911&oldid=149910 5* 03Blashyrkh 5* (+253) 10 > 1736524857 962151 PRIVMSG #esolangs :14[[07User:Aadenboy/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=149912&oldid=139680 5* 03Aadenboy 5* (-4807) 10test < 1736525305 72464 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736527240 544371 PRIVMSG #esolangs :14[[07User:Aadenboy/Program states14]]4 N10 02https://esolangs.org/w/index.php?oldid=149913 5* 03Aadenboy 5* (+288) 10Created page with "mostly random ideas. zzz. == Switch-bait == A program is Switch-bait if it can: * Take an input from the user * Store the value permanently * Silently use that value within computations * Immediately change the value for something else when the use < 1736530078 581800 :true-grue!~true-grue@95-24-39-132.broadband.corbina.ru QUIT :Quit: Client closed > 1736531736 950784 PRIVMSG #esolangs :14[[07User:AdjectiveNounNumber14]]4 N10 02https://esolangs.org/w/index.php?oldid=149914 5* 03AdjectiveNounNumber 5* (+6) 10Created page with "ijijij" < 1736533712 292450 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736534138 890029 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736534184 482683 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds < 1736534250 20014 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) < 1736534315 733953 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life < 1736534371 189020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736534435 475380 PRIVMSG #esolangs :14[[07Condit14]]4 10 02https://esolangs.org/w/index.php?diff=149915&oldid=140253 5* 0347 5* (-3) 10/* Truth-machine */ > 1736534458 335463 PRIVMSG #esolangs :14[[07Condit14]]4 10 02https://esolangs.org/w/index.php?diff=149916&oldid=149915 5* 0347 5* (+0) 10/* Examples */ > 1736534787 968243 PRIVMSG #esolangs :14[[07Convert14]]4 10 02https://esolangs.org/w/index.php?diff=149917&oldid=149856 5* 03AdjectiveNounNumber 5* (+27) 10 > 1736536276 118214 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149918&oldid=149730 5* 03Aadenboy 5* (+356) 10/* category removal */ new section > 1736536459 561127 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=149919&oldid=149875 5* 03Aadenboy 5* (+56) 10 > 1736536810 901776 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5* 10deleted "[[02Category:Discussion10]]": undiscussed category, redundant to [[Special:AllPages/Talk:]] > 1736536875 405966 PRIVMSG #esolangs :14[[07Category talk:Discussion14]]4 10 02https://esolangs.org/w/index.php?diff=149920&oldid=149876 5* 03Ais523 5* (+17) 10nowiki link to deleted category (as it's important to understand the context of the page, which was not deleted because it helps to explain why the category was deleted) > 1736536891 246065 PRIVMSG #esolangs :14[[07Talk:Xand14]]4 10 02https://esolangs.org/w/index.php?diff=149921&oldid=149870 5* 03Ais523 5* (-24) 10rm deleted category > 1736536930 194791 PRIVMSG #esolangs :14[[07User talk:Ais52314]]4 10 02https://esolangs.org/w/index.php?diff=149922&oldid=149918 5* 03Ais523 5* (+269) 10/* category removal */ deleted > 1736537739 390999 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149923&oldid=149678 5* 0347 5* (+106) 10 < 1736538273 465973 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736539772 365908 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736539912 462752 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736540910 694412 PRIVMSG #esolangs :14[[07User:Aadenboy/Program states14]]4 10 02https://esolangs.org/w/index.php?diff=149924&oldid=149913 5* 03Aadenboy 5* (-288) 10never mind! this is dumb! aagh! < 1736541759 264969 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736541878 846102 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736542748 391270 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode < 1736542912 788137 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity < 1736546598 691591 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736547279 881790 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736547939 328019 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736548624 316969 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull < 1736551285 116612 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736553840 428628 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 246 seconds < 1736553950 620508 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736554039 578460 PRIVMSG #esolangs :14[[07User:Aadenboy/00=014]]4 M10 02https://esolangs.org/w/index.php?diff=149925&oldid=149879 5* 03Aadenboy 5* (-148) 10thanks render errors < 1736556127 574602 :supercode!~supercode@user/supercode QUIT :Quit: Client closed < 1736556259 221420 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 JOIN #esolangs * :realname < 1736556420 940539 :craigo_!~craigo@180-150-37-38.b49625.bne.nbn.aussiebb.net QUIT :Ping timeout: 252 seconds < 1736558912 220868 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :reading my mailserver log for weird things happening, I saw an HTTP request to the SMTP submission port, which looks a bit like it might be from a search engine < 1736558945 320316 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it looks like it followed a link to the IP+port pair < 1736558971 209543 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and, well, anyone can put a link to any IP+port pair onto the web, but I'm vaguely surprised that someone actually did < 1736559077 437993 :int-e!~noone@int-e.eu PRIVMSG #esolangs :hmm. search engines might pick up on something like foo.bar:123 and try HTTP requests there? < 1736559113 218240 :int-e!~noone@int-e.eu PRIVMSG #esolangs :in these desparate times where we need every byte of training material for LLMs that we can find < 1736559163 29293 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :I don't know why anyone would even have a link to my SMTP submission port, it's not like it's usable by anyone but me < 1736559187 620422 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :my guess is that it's on some sort of list intended for use by spammers, who don't know how many of the ports are usable (but must surely suspect that most of them aren't) < 1736559209 718523 :int-e!~noone@int-e.eu PRIVMSG #esolangs :it could just be a weird port scan too < 1736559233 52171 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :port scans don't usually send HTTP requests but I guess they *could* < 1736559286 698793 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Anyway, all I have is speculation. This doesn't sound familiar in any way :) < 1736559328 573961 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :right, it was weird enough to be worth commenting on :-) < 1736559347 772708 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it likely isn't a problem – mailservers get so many random attacks as it is – but it's strange enough to have made me curious < 1736559363 658489 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I get that < 1736559404 778117 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Like... I keep looking at spam mails and wondering what the underlying scam is. Which is about equally fruitless. < 1736559440 382052 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :in some of them, the scam appears to have been perpetrated against the sender, who has been falsely convinced by some spambot vender that the spam mail will do something useful < 1736559461 158126 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Subject: Mail delivery failed: returning message to sender <-- meh, is that still a spam delivery vector < 1736559474 562266 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :spam with unsubstituted placeholders is always fun, when you get a literal "$FEMALE_NAME" in the email rather than a random female name < 1736559516 562967 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :apparently many spammers don't test their spamcannons very thoroughly < 1736560281 640040 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I have seen TLS client hello messages on port 80 of my server < 1736560712 235779 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :On my SMTP server, I have gotten HTTP requests, TLS client hello messages, JSON (something relating to Ethereum mining, it seems), and attempts to send messages to email addresses that do not exist on my server, and attempts at relaying messages (which are rejected by my server). < 1736560752 398095 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Is that what "\x16\x03\x01" is? Hmm. < 1736560792 938478 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I think "\x16\x03\x01" is the beginning of a TLS client hello message. < 1736560824 758234 :int-e!~noone@int-e.eu PRIVMSG #esolangs :What are things like GET /.env scanning for? < 1736560847 556865 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :I don't know what that is. < 1736561128 498026 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Huh, this one is odd too. GET /+CSCOE+/logon.html ..."CSCOE is a nonprofit organization that transforms Catholic education through innovative and entrepreneurial approaches." < 1736561128 660753 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :(scorpiond does not currently log all invalid requests, although I could change that. So, I don't know if any HTTP requests or TLS client hello messages are received on that server. Actually the specification says that TLS client hello is valid, but that servers are not required to implement it, and currently it is not implemented.) < 1736561174 158111 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I guess that makes sense if they provide IT support (setting up web servers for schools) < 1736561242 518334 :int-e!~noone@int-e.eu PRIVMSG #esolangs :But whatever... still the usual scans with a few fun outliers, though the .env thing was new to me. > 1736561579 826076 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=149926&oldid=149888 5* 03Calculus is fun 5* (+6) 10/* Commands */ < 1736562516 921760 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving < 1736562586 974737 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her) < 1736564227 254161 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement < 1736564713 77167 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in < 1736564776 100494 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in < 1736565762 746778 :nitrix!~nitrix@user/meow/nitrix QUIT :Quit: ZNC 1.8.2 - https://znc.in < 1736565823 404798 :nitrix!~nitrix@user/meow/nitrix JOIN #esolangs nitrix :ZNC - https://znc.in > 1736569286 750175 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox/My Rate to the user that I know14]]4 10 02https://esolangs.org/w/index.php?diff=149927&oldid=148893 5* 03PrySigneToFry 5* (+1) 10ZCX islptng was changed his username to I am islptng, so I had to fix the username < 1736569984 967962 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 260 seconds > 1736570213 38085 PRIVMSG #esolangs :14[[07Talk:Uyjhmn n14]]4 10 02https://esolangs.org/w/index.php?diff=149928&oldid=142449 5* 03PrySigneToFry 5* (+94) 10/* ? */ new section > 1736570290 441834 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=149929&oldid=149825 5* 03PrySigneToFry 5* (+13) 10 > 1736570415 999928 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149930&oldid=149901 5* 03PrySigneToFry 5* (+334) 10 < 1736571172 303066 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736571354 249105 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 N10 02https://esolangs.org/w/index.php?oldid=149931 5* 03ClearLimediWater 5* (+280) 10Created page with "'''Luke's Box Programming'''LBP[[User:ClearLimediWater]][[esoteric programming language|Esolang]] '''Luke's Box Programming''' (abbreviated as LBP) is an [[esoteric programming language]] made by [[User:ClearLimediWater]]. [[Category:Languages]] > 1736571617 394519 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=149932&oldid=149929 5* 03ClearLimediWater 5* (+42) 10 > 1736572383 38437 PRIVMSG #esolangs :14[[07Definitely unusable14]]4 M10 02https://esolangs.org/w/index.php?diff=149933&oldid=144715 5* 03PrySigneToFry 5* (+274) 10 > 1736572687 672893 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03SerialDesignationF 5* 10New user account < 1736573408 842645 :yewscion!~yewscion@172.59.136.21 JOIN #esolangs yewscion :Claire Rodriguez < 1736573483 101587 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez < 1736573684 461899 :yewscion!~yewscion@172.59.136.21 QUIT :Ping timeout: 252 seconds > 1736573693 163834 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=149934&oldid=149899 5* 03PrySigneToFry 5* (+436) 10 < 1736576372 173686 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer > 1736578309 530039 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Edward Z 5* 10New user account > 1736578438 575421 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=149935&oldid=149894 5* 03Edward Z 5* (+69) 10 > 1736578636 198461 PRIVMSG #esolangs :14[[07Starry14]]4 10 02https://esolangs.org/w/index.php?diff=149936&oldid=38232 5* 03Edward Z 5* (+2311) 10 < 1736579381 184587 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 QUIT :Ping timeout: 252 seconds < 1736579908 132531 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736580798 358291 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths > 1736582459 947225 PRIVMSG #esolangs :14[[07Marb14]]4 10 02https://esolangs.org/w/index.php?diff=149937&oldid=149923 5* 0347 5* (+4) 10/* Syntax */ < 1736582654 803348 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736584893 835945 :ais523!~ais523@user/ais523 QUIT :Quit: quit < 1736586888 83442 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736589166 548901 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity < 1736589655 736283 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer > 1736590131 415875 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 N10 02https://esolangs.org/w/index.php?oldid=149938 5* 03PrySigneToFry 5* (+39) 10Created page with "" > 1736590328 569692 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149939&oldid=149597 5* 03PrySigneToFry 5* (+56) 10 > 1736590640 878328 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149940&oldid=149729 5* 03PrySigneToFry 5* (+1537) 10 > 1736590849 254936 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149941&oldid=149940 5* 03PrySigneToFry 5* (+214) 10 > 1736591047 374775 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=149942&oldid=148122 5* 03PrySigneToFry 5* (+978) 10/* Check out my(and None1's) Esolang! */ new section > 1736591777 469810 PRIVMSG #esolangs :14[[07Permission denied14]]4 10 02https://esolangs.org/w/index.php?diff=149943&oldid=142922 5* 03PrySigneToFry 5* (+553) 10 > 1736593237 558000 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=149944&oldid=149884 5* 03I am islptng 5* (+1191) 10 < 1736596971 270717 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 244 seconds < 1736597127 720227 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User < 1736597605 724428 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736598006 1242 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1736598170 372214 :APic!apic@apic.name PRIVMSG #esolangs :Hi < 1736598216 980715 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net PRIVMSG #esolangs :hi < 1736598964 651181 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736599106 746762 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736599258 677651 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149945&oldid=149938 5* 03ClearLimediWater 5* (+116) 10 > 1736599382 287134 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=149946&oldid=149931 5* 03ClearLimediWater 5* (-49) 10 > 1736599425 566213 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149947&oldid=149945 5* 03ClearLimediWater 5* (+6) 10 > 1736599838 862830 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149948&oldid=149836 5* 03ClearLimediWater 5* (+124) 10 < 1736599890 187884 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 JOIN #esolangs * :realname < 1736599893 769742 :craigo__!~craigo@2403:5815:da48:0:a1aa:83b:a8a5:bab4 QUIT :Remote host closed the connection < 1736599947 130120 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname > 1736600550 661325 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149949&oldid=149947 5* 03ClearLimediWater 5* (+143) 10 < 1736600611 263142 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode > 1736600704 828584 PRIVMSG #esolangs :14[[07WaifuScript14]]4 N10 02https://esolangs.org/w/index.php?oldid=149950 5* 03Juanp32 5* (+1158) 10made this esolang to troll my cs teacher lol > 1736600875 751805 PRIVMSG #esolangs :14[[07Joke language list14]]4 10 02https://esolangs.org/w/index.php?diff=149951&oldid=149711 5* 03Juanp32 5* (+78) 10/* General languages */ > 1736600959 4191 PRIVMSG #esolangs :14[[07User:Juanp3214]]4 10 02https://esolangs.org/w/index.php?diff=149952&oldid=149593 5* 03Juanp32 5* (+52) 10/* languages i made, i guess */ < 1736601053 693766 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat > 1736601161 223572 PRIVMSG #esolangs :14[[07WaifuScript14]]4 M10 02https://esolangs.org/w/index.php?diff=149953&oldid=149950 5* 03Juanp32 5* (-1) 10tyop > 1736601454 383183 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ClearLimediWater 5* 10uploaded "[[02File:Wankong497 01.jpg10]]": CLW < 1736601485 327197 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736601975 71785 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=149955&oldid=149948 5* 03ClearLimediWater 5* (+241) 10 > 1736602337 959159 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 M10 02https://esolangs.org/w/index.php?diff=149956&oldid=149955 5* 03ClearLimediWater 5* (+93) 10 < 1736602421 358454 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736603646 641551 :Guest75!~Guest75@2a02:6b67:d4b0:5e00:adaa:cb6a:5ede:ba4d JOIN #esolangs * :[https://web.libera.chat] Guest75 < 1736603674 361965 :Guest75!~Guest75@2a02:6b67:d4b0:5e00:adaa:cb6a:5ede:ba4d QUIT :Client Quit > 1736603691 526833 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=149957&oldid=149946 5* 03ClearLimediWater 5* (+1274) 10 < 1736604003 692439 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat > 1736604031 41084 PRIVMSG #esolangs :14[[07Hito14]]4 M10 02https://esolangs.org/w/index.php?diff=149958&oldid=149841 5* 03TheCanon2 5* (+74) 10grammar < 1736604238 928512 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname < 1736605008 365410 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736605109 719064 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736605113 276524 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736606784 37608 PRIVMSG #esolangs :14[[07User:ZCX islptng14]]4 10 02https://esolangs.org/w/index.php?diff=149959&oldid=149939 5* 0347 5* (-56) 10pstf shut up > 1736606859 659069 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149960&oldid=149941 5* 0347 5* (-1751) 10and? > 1736606884 64374 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=149961&oldid=149960 5* 0347 5* (+1537) 10 < 1736608009 948648 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736609593 68486 :supercode!~supercode@user/supercode QUIT :Quit: Client closed > 1736610286 979398 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03ZachChecksOutEsolangs 5* 10uploaded "[[02File:Factorial Program.png10]]" > 1736610312 360778 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149963&oldid=144775 5* 03ZachChecksOutEsolangs 5* (+67) 10 > 1736610341 652031 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149964&oldid=149963 5* 03ZachChecksOutEsolangs 5* (+0) 10 > 1736610367 803019 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149965&oldid=149964 5* 03ZachChecksOutEsolangs 5* (+0) 10 > 1736610386 148997 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149966&oldid=149965 5* 03ZachChecksOutEsolangs 5* (+0) 10 < 1736610394 135159 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths > 1736610466 520432 PRIVMSG #esolangs :14[[07Black Pentagon14]]4 10 02https://esolangs.org/w/index.php?diff=149967&oldid=149966 5* 03ZachChecksOutEsolangs 5* (+116) 10 < 1736611098 329850 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode < 1736611198 525374 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736612833 842126 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736614373 473921 PRIVMSG #esolangs :14[[07WaidWmy14]]4 10 02https://esolangs.org/w/index.php?diff=149968&oldid=146980 5* 03AlmostGalactic 5* (+557) 10 < 1736616406 240036 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736616960 439069 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736617280 185496 PRIVMSG #esolangs :14[[07GotoScript14]]4 10 02https://esolangs.org/w/index.php?diff=149969&oldid=119909 5* 03Quito0567 5* (+1) 10 < 1736620570 472501 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736620630 15756 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 260 seconds < 1736620653 732383 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity < 1736620748 82212 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life < 1736620833 436396 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736622109 349007 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 N10 02https://esolangs.org/w/index.php?oldid=149970 5* 03Tommyaweosme 5* (+1100) 10Created page with " - Paliraworld.kgm - Paliraworld.kgm 2016-2021 -Paliraworld.kgm Paliraworld.kgm Paliraworld.kgm ..." > 1736622149 717979 PRIVMSG #esolangs :14[[07Translated /PSTF Again214]]4 10 02https://esolangs.org/w/index.php?diff=149971&oldid=146375 5* 03Tommyaweosme 5* (+66) 10 < 1736622408 712930 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736623577 994430 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname > 1736624742 361025 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Befalsia10]] to [[Switch gr]] > 1736624804 500443 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149974&oldid=149972 5* 0347 5* (+71) 10 > 1736624976 523959 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149975&oldid=149974 5* 0347 5* (-146) 10 > 1736625217 338990 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:Off default.png10]]" > 1736625341 97732 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:On default.png10]]" > 1736625434 677994 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:Off alt.png10]]" > 1736625493 147472 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149979&oldid=149975 5* 0347 5* (+199) 10/* Swiches */ > 1736625506 837041 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 0347 5* 10uploaded "[[02File:On alt.png10]]" > 1736625598 920309 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149981&oldid=149979 5* 0347 5* (-3) 10 > 1736625628 578612 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149982&oldid=149981 5* 0347 5* (+3) 10 > 1736625922 728937 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=149983&oldid=149982 5* 0347 5* (+114) 10 < 1736626271 137656 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown > 1736626594 601020 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149984&oldid=149862 5* 03Ractangle 5* (+1) 10/* Stuff to continue */ > 1736626616 697849 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149985&oldid=149984 5* 03Ractangle 5* (-12) 10/* Stuff to continue */ > 1736626681 183539 PRIVMSG #esolangs :14[[07Hum14]]4 10 02https://esolangs.org/w/index.php?diff=149986&oldid=149095 5* 03Ractangle 5* (-868) 10Redirected page to [[Jive]] > 1736626701 204475 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=149987&oldid=149677 5* 03Ractangle 5* (-10) 10/* Esolangs */ > 1736627049 301898 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149988&oldid=144802 5* 03Ractangle 5* (-110) 10/* Syntax */ > 1736627145 285516 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149989&oldid=149988 5* 03Ractangle 5* (+1) 10/* Hello, world! */ > 1736627391 999266 PRIVMSG #esolangs :14[[07JAGL14]]4 10 02https://esolangs.org/w/index.php?diff=149990&oldid=149989 5* 03Ractangle 5* (+0) 10/* Interpreter */ > 1736627404 14851 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Ractangle 5* 10moved [[02JAGL10]] to [[Just]] > 1736627504 619240 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149993&oldid=149991 5* 03Ractangle 5* (+39) 10 < 1736627737 745793 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736627908 39293 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149994&oldid=149993 5* 03Ractangle 5* (+0) 10/* Interpreter */ < 1736627950 683000 :supercode!~supercode@user/supercode QUIT :Ping timeout: 240 seconds > 1736627952 610385 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=149995&oldid=149985 5* 03Ractangle 5* (+0) 10/* Stuff to continue */ < 1736627963 228750 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode > 1736628024 994343 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149996&oldid=149994 5* 03Ractangle 5* (-99) 10/* Syntax */ < 1736628048 761053 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything < 1736628057 865641 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) > 1736628145 393348 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149997&oldid=149996 5* 03Ractangle 5* (+43) 10 < 1736628201 709123 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1736628215 989279 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149998&oldid=149997 5* 03Ractangle 5* (+16) 10/* Syntax */ > 1736628940 680847 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=149999&oldid=149998 5* 03Ractangle 5* (+16) 10/* Syntax */ > 1736628984 196976 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150000&oldid=149999 5* 03Ractangle 5* (+29) 10/* Examples */ < 1736629983 974632 :chiselfuse!~chiselfus@user/chiselfuse QUIT :Remote host closed the connection < 1736630063 899149 :chiselfuse!~chiselfus@user/chiselfuse JOIN #esolangs chiselfuse :chiselfuse > 1736630454 935059 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150001&oldid=143785 5* 03Ractangle 5* (-14) 10/* Commands */ > 1736630715 524154 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Ractangle 5* 10uploaded a new version of "[[02File: logo.png10]]" < 1736631037 551527 :supercode!~supercode@user/supercode QUIT :Quit: Client closed < 1736631494 718219 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736631695 876426 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736631954 3201 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150003&oldid=145268 5* 03Ractangle 5* (+4) 10Changed redirect target from [[User:Ractangle/Sandbox#Rating and people]] to [[User:Ractangle/Sandbox#Opinions about people]] < 1736632872 416995 :__monty__!~toonn@user/toonn QUIT :Quit: leaving > 1736633122 646724 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150004&oldid=150003 5* 03Ais523 5* (+192) 10rv edit of a page about an esolang to redirect to a userspace page that isn't an esolang that isn't an appropriate use for mainspace > 1736633403 932659 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150005&oldid=149348 5* 03Ais523 5* (+849) 10/* Please stop breaking mainspace links by moving pages */ new section < 1736633488 830087 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :oh no, this is going to be a huge mess to sort out < 1736633514 589884 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :https://esolangs.org/wiki/Special:Log?type=move&user=Ractangle for anyone who is wondering about the mess < 1736633792 204645 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736636128 255088 PRIVMSG #esolangs :14[[07Braine14]]4 10 02https://esolangs.org/w/index.php?diff=150006&oldid=68175 5* 03Kaveh Yousefi 5* (+289) 10Rectified the memory description from the bit to the byte type, extended the instructions elucidation by the line numbering concept, and supplemented a page category tag. < 1736636144 643608 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving > 1736636276 668308 PRIVMSG #esolangs :14[[07Braine14]]4 10 02https://esolangs.org/w/index.php?diff=150007&oldid=150006 5* 03Kaveh Yousefi 5* (+491) 10Introduced an examples section comprehending one inicipial member, added a hyperlink to my implementation on GitHub, and supplemented the Implemented category tag. < 1736636600 8284 :shmup!~shmup@dev.host QUIT :Remote host closed the connection > 1736636798 751004 PRIVMSG #esolangs :14[[07Pyline14]]4 10 02https://esolangs.org/w/index.php?diff=150008&oldid=149431 5* 03Jan jelo 5* (+27) 10/* Quine */ > 1736638157 374973 PRIVMSG #esolangs :14[[07BF Joust champions14]]4 10 02https://esolangs.org/w/index.php?diff=150009&oldid=149742 5* 03Ais523 5* (+180) 10/* 2009 */ make a modern-syntax version of jix_wiggle3 so that it can be tested against today's hills < 1736638326 665978 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Gregor_sucralose_philip: points -1.00, score 17.83, rank 24/47 < 1736638349 690479 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :that one scores shockingly well for a program from 2011 < 1736638652 101288 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :it seems to be primarily due to programs that simply can't deal with the opponent using a forward decoy setup < 1736638819 410298 :zemhill!bfjoust@selene.zem.fi PRIVMSG #esolangs :web.Lymia_nyuroki2: points 10.21, score 30.22, rank 6/47 < 1736638858 205391 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :and that one is stronger than nyuroki3, which may have been overfitted < 1736640184 415508 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds < 1736640333 226746 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1736643184 667154 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150010&oldid=149944 5* 03PrySigneToFry 5* (+845) 10 > 1736643201 538949 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150011&oldid=150010 5* 03PrySigneToFry 5* (+0) 10Fixed time < 1736643413 109533 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds > 1736643717 549971 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=150012&oldid=149961 5* 03PrySigneToFry 5* (+773) 10 > 1736644107 518587 PRIVMSG #esolangs :14[[07Nope.14]]4 M10 02https://esolangs.org/w/index.php?diff=150013&oldid=148992 5* 03PrySigneToFry 5* (+242) 10 > 1736644359 963303 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150014&oldid=149934 5* 03PrySigneToFry 5* (+81) 10 > 1736644598 907793 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150015&oldid=149970 5* 03PrySigneToFry 5* (+48) 10 > 1736645119 134981 PRIVMSG #esolangs :14[[07Translated /PSTF Again314]]4 N10 02https://esolangs.org/w/index.php?oldid=150016 5* 03PrySigneToFry 5* (+1924) 10Created page with "[[Translated /tommyaweosme]] is not crazy enough, so let's be crazier!!!!!! 1. Drag out that scarred program
 -   .kgm        -   .kgm 2016-2021              -   ..."
> 1736646135 501060 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150017&oldid=149930 5* 03PrySigneToFry 5* (+423) 10
< 1736646500 410813 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736646794 504490 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150018&oldid=149956 5* 03ClearLimediWater 5* (+27) 10
> 1736647064 401247 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 10 02https://esolangs.org/w/index.php?diff=150019&oldid=149957 5* 03ClearLimediWater 5* (+110) 10
> 1736647169 897387 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 N10 02https://esolangs.org/w/index.php?oldid=150020 5* 03ClearLimediWater 5* (+753) 10Created page with "'''Luke's Box Pseudocode''' (abbreviated as LBP2) is an ''not very'' [[esoteric programming language]] made by [[User:ClearLimediWater]].  == Introduction ==  This is a simplified version of LBP1.  == Examples ==  === [[Hello, world!]] ===   FUNC{ 
< 1736647356 109630 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving
< 1736647364 162745 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Quit: iovoid has quit!
< 1736647364 200145 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Read error: Connection reset by peer
< 1736651103 891828 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection
< 1736651134 135770 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
> 1736653015 993554 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150021&oldid=150020 5* 03ClearLimediWater 5* (-250) 10/* Hello, world! */
> 1736653389 273167 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150022&oldid=149949 5* 03ClearLimediWater 5* (+133) 10
< 1736653397 53074 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
> 1736653452 762185 PRIVMSG #esolangs :14[[07User:Tommyaweosme/BRING BACK THE OLD SANDBOX14]]4 10 02https://esolangs.org/w/index.php?diff=150023&oldid=149442 5* 03PrySigneToFry 5* (+14) 10fixed
< 1736653511 991801 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736653624 70147 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
< 1736655655 250548 :moony!moony@hellomouse/dev/moony QUIT :Quit: leaving
< 1736655659 132928 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Quit: Blame iczero something happened
< 1736655659 171193 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Quit: iovoid has quit!
> 1736655845 493937 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150024&oldid=150019 5* 03ClearLimediWater 5* (-6) 10/* Commands */
< 1736655960 183119 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736656075 68862 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736656178 190894 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :continuous <= discrete <= continuous <= ...
> 1736662214 755703 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150025&oldid=150021 5* 03ClearLimediWater 5* (+33) 10
< 1736662815 657112 :Guest2!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736662848 797391 :Guest2!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736662877 639684 :Guest71!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736662889 368473 :Guest71!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736662903 640596 :Guest31!~Guest91@234.65.2.110.ap.yournet.ne.jp JOIN #esolangs * :[https://web.libera.chat] Guest91
< 1736663039 91056 :Guest31!~Guest91@234.65.2.110.ap.yournet.ne.jp QUIT :Client Quit
< 1736663650 675460 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736663676 722282 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit
< 1736664181 349613 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736665214 325963 PRIVMSG #esolangs :14[[07User talk:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150026&oldid=150005 5* 03Ractangle 5* (+172) 10/* Please stop breaking mainspace links by moving pages */
> 1736665268 187936 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150027&oldid=150004 5* 03Ractangle 5* (-178) 10
> 1736665340 433033 PRIVMSG #esolangs :14[[07Blocked14]]4 10 02https://esolangs.org/w/index.php?diff=150028&oldid=150027 5* 03Ractangle 5* (+7) 10
< 1736668833 119102 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736671013 233658 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Vertical Tab 'N 5*  10New user account
> 1736671062 857980 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150029&oldid=149935 5* 03Vertical Tab 'N 5* (+152) 10
> 1736671235 663822 PRIVMSG #esolangs :14[[07User:Vertical tab 'N14]]4 N10 02https://esolangs.org/w/index.php?oldid=150030 5* 03Vertical Tab 'N 5* (+1051) 10I temporarily stored this in another wiki's sandbox.
< 1736671599 310183 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736671684 435653 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736672107 286734 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736672258 232621 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736672452 169853 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150031&oldid=150000 5* 03Ractangle 5* (-3) 10
> 1736674143 656797 PRIVMSG #esolangs :14[[07Snakel/Compatibility methods14]]4 10 02https://esolangs.org/w/index.php?diff=150032&oldid=147836 5* 03Ractangle 5* (+13) 10/* Ultium */
> 1736678480 598593 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox/Some useless code14]]4 N10 02https://esolangs.org/w/index.php?oldid=150033 5* 03PrySigneToFry 5* (+1752) 10Created page with "= C/C++ = == Wouldn't it be better to just comment it out? == 
 while(false) {     // TODO } 
 if(false) {     // TODO } 
== It'll definitely execute ==
 #include --snip-- if(1 == 1) {     if
> 1736678515 895233 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150034&oldid=141723 5* 03PrySigneToFry 5* (+95) 10
> 1736678541 820699 PRIVMSG #esolangs :14[[07User:PrySigneToFry/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150035&oldid=150034 5* 03PrySigneToFry 5* (-26) 10
> 1736678834 12884 PRIVMSG #esolangs :14[[07Anti-Plushie language/PSTF14]]4 10 02https://esolangs.org/w/index.php?diff=150036&oldid=149461 5* 03PrySigneToFry 5* (+37) 10
> 1736679154 190658 PRIVMSG #esolangs :14[[07+14]]4 10 02https://esolangs.org/w/index.php?diff=150037&oldid=149460 5* 03PrySigneToFry 5* (+158) 10
< 1736680078 337174 :supercode!~supercode@user/supercode JOIN #esolangs supercode :[https://web.libera.chat] supercode
< 1736681525 951719 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736683420 505109 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736683544 428378 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1736684542 562792 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150038&oldid=150015 5* 03I am islptng 5* (+49) 10
> 1736684555 822692 PRIVMSG #esolangs :14[[07Translated /tommyaweosme14]]4 10 02https://esolangs.org/w/index.php?diff=150039&oldid=150038 5* 03I am islptng 5* (-1) 10
> 1736684645 513680 PRIVMSG #esolangs :14[[07Translated /PSTF Again314]]4 10 02https://esolangs.org/w/index.php?diff=150040&oldid=150016 5* 03I am islptng 5* (+87) 10
< 1736684720 371878 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736685244 590676 PRIVMSG #esolangs :14[[07Translated /islptng Again 214]]4 N10 02https://esolangs.org/w/index.php?oldid=150041 5* 03I am islptng 5* (+1892) 10Created page with "1.Take that [[Translated /PSTF Again3|]].             Macintosh          Macintosh    ..."
< 1736686165 4343 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736687096 731098 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox/Titin14]]4 N10 02https://esolangs.org/w/index.php?oldid=150042 5* 03I am islptng 5* (+21166) 10Created page with "
 mttgaptftgplgsvvvluystatfuahisyfpvpuvsrfndygviststlpyvgisfsdynakltipavtkaqsynoslkatqysygatstaullvkautappqfvgnlgsmtvngysgvnlgvnvtyipqpvvkfondyauigssldfgisguydloslliauaopudsytosvqatqsvynatstaullvgyuuuvpakktktivstagisusngtniukkiuahfdansi
> 1736687183 131556 PRIVMSG #esolangs :14[[07User:I am islptng/Sandbox/Titin14]]4 10 02https://esolangs.org/w/index.php?diff=150043&oldid=150042 5* 03I am islptng 5* (+379) 10
< 1736687968 259977 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1736688736 238384 PRIVMSG #esolangs :14[[07Titin14]]4 N10 02https://esolangs.org/w/index.php?oldid=150044 5* 03I am islptng 5* (+42147) 10Created page with "{{wrongtitle|title=Methionylthreonylthreonylalanylprolyl...leucylarginylthreonylserylvalylis}}
This is a trivial [[brainstack(islptng)|brainstack]] substitution. ==Syntax== Every program starts with the first 9999 letters of titin: methionylthreonylthreonylgl > 1736688815 54698 PRIVMSG #esolangs :14[[07User:I am islptng14]]4 10 02https://esolangs.org/w/index.php?diff=150045&oldid=149865 5* 03I am islptng 5* (+59) 10 < 1736690569 147354 :supercode!~supercode@user/supercode QUIT :Quit: Client closed < 1736690742 715142 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736691440 928280 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown > 1736692017 908837 PRIVMSG #esolangs :14[[07Translated /islptng Again 214]]4 10 02https://esolangs.org/w/index.php?diff=150046&oldid=150041 5* 03MihaiEso 5* (+46) 10 < 1736692921 221165 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname > 1736692975 414389 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150047&oldid=150014 5* 03PrySigneToFry 5* (+301) 10 > 1736693167 535559 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 N10 02https://esolangs.org/w/index.php?oldid=150048 5* 03MihaiEso 5* (+2718) 10Created page with "1.Take that [[Translated /islptng Again 2|]]. 75 De Feed Nutrition Tokuho 2. Mix well with 2500000 bags of instant noodles, 100000 liters of Coca-Cola, 100000..." > 1736693579 478199 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150049&oldid=150047 5* 03PrySigneToFry 5* (+1163) 10 > 1736693820 289236 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150050&oldid=150049 5* 03PrySigneToFry 5* (+226) 10 < 1736694126 712218 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736696114 16785 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736696262 759891 PRIVMSG #esolangs :14[[07Talk:Translated /Mihai Again!14]]4 N10 02https://esolangs.org/w/index.php?oldid=150051 5* 03I am islptng 5* (+957) 10Created page with "
100000 liters of liquid nitrogen at -999999999999 degrees Celsius
Fun fact: Nitrogen at -273.15 degree Celsius (or below) is solid. Also, everybody actually can't freeze something to -273.16 degree Celsius.
1736697572 98308 PRIVMSG #esolangs :14[[07Talk:14]]4 N10 02https://esolangs.org/w/index.php?oldid=150052 5* 03I am islptng 5* (+604) 10Created page with "How to use library Kitten4? By the way I'm still a fan of Kitten4. ~~~~" < 1736698154 215204 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736698202 649709 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736699681 33120 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name) < 1736699761 718728 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736699776 963803 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection > 1736702596 714426 PRIVMSG #esolangs :14[[07User talk:/w/wiki/index.php/Talk:index.php/Main page14]]4 10 02https://esolangs.org/w/index.php?diff=150053&oldid=150012 5* 03Juanp32 5* (+137) 10 > 1736703133 665121 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 0347 5* 10moved [[02Titin10]] to [[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]] > 1736703173 260191 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move_redir10 02 5* 0347 5* 10moved [[02Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh10]] to [[Titin]] over redirect: Revert > 1736703173 283483 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete_redir10 02 5* 0347 5* 1047 deleted redirect [[02Titin10]] by overwriting: Deleted to make way for move from "[[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]]" > 1736703567 277175 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150058&oldid=150031 5* 0347 5* (-32) 10/* Syntax */ > 1736703574 35046 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150059&oldid=150058 5* 0347 5* (-3) 10/* Cat program */ < 1736705450 106134 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736706939 876229 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736707006 193536 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord < 1736707035 450896 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 246 seconds < 1736707104 676304 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736707184 38104 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life < 1736707258 795220 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736707359 972246 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT : < 1736707363 720386 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736707443 6425 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull < 1736707572 800873 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736708074 138703 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez < 1736708581 158290 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez < 1736708725 171382 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 248 seconds < 1736711092 38325 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname < 1736711728 672756 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736712367 376860 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736712465 818499 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736713030 643230 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Ping timeout: 240 seconds < 1736713240 577598 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat < 1736713568 440525 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection < 1736714622 927622 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds > 1736715926 552694 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03FluixMakesEsolangs 5* 10New user account < 1736716031 605247 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1736716137 669483 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 M10 02https://esolangs.org/w/index.php?diff=150060&oldid=150029 5* 03FluixMakesEsolangs 5* (+129) 10/* Introductions */ < 1736716200 903369 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1736718318 501810 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Remote host closed the connection < 1736718395 472539 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez < 1736720649 190165 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1736721631 576583 :__monty__!~toonn@user/toonn QUIT :Quit: leaving < 1736724047 67938 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds > 1736724584 943777 PRIVMSG #esolangs :14[[07User:Jan jelo/Lambda to SKI14]]4 N10 02https://esolangs.org/w/index.php?oldid=150061 5* 03Jan jelo 5* (+1559) 10Created page with "This is a converter in Haskell converts lambda calculus into SKI combinators.
 main = do  print $ convert $ omega  -- ((s i) i)  print $ convert $ turing  -- (((s i) i) ((s (k (s i))) ((s ((s (k s)) ((s (k k)) ((s i) i)))) (k i
> 1736724771 982971 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150062&oldid=149583 5* 03Jan jelo 5* (+33) 10/* Other */
< 1736725506 95486 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736725747 804472 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150063&oldid=150048 5* 03I am islptng 5* (+12) 10fix
< 1736726628 67785 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736726825 95369 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736727731 707517 :voxpelli!sid31634@id-31634.tinside.irccloud.com JOIN #esolangs voxpelli :Pelle Wessman
> 1736728194 620916 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 M10 02https://esolangs.org/w/index.php?diff=150064&oldid=147835 5* 03Calculus is fun 5* (+90) 10Added MoreMathRPN example
> 1736728740 570247 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150065&oldid=149700 5* 03PkmnQ 5* (+522) 10/* Examples */
< 1736728743 675185 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1736728764 166249 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150066&oldid=150065 5* 03PkmnQ 5* (+1) 10/* > */ Fish
> 1736728866 851507 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150067&oldid=150066 5* 03PkmnQ 5* (+4) 10/* Fish */
< 1736728948 362993 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736729013 207208 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=150068&oldid=149848 5* 03TheCanon2 5* (+62) 10
> 1736729991 878303 PRIVMSG #esolangs :14[[07Looping counter14]]4 M10 02https://esolangs.org/w/index.php?diff=150069&oldid=149215 5* 03Calculus is fun 5* (+84) 10Added MoreMathRPN example
> 1736732250 629084 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 N10 02https://esolangs.org/w/index.php?oldid=150070 5* 03TheCanon2 5* (+788) 10Created page with "In the video [https://www.youtube.com/watch?v=QyzNsOhshis| "We Built A Computer in Mario Maker!"], the Game Theorists describe a machine made in Mario Maker that uses logic gates to add two numbers from 0-7 and prints the result as
> 1736732736 467703 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150071&oldid=150024 5* 03ClearLimediWater 5* (+0) 10/* Commands */
> 1736732751 808498 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150072&oldid=147690 5* 03BestCoder 5* (+102) 10
> 1736732874 359208 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150073&oldid=150071 5* 03ClearLimediWater 5* (+0) 10/* Commands */
< 1736732928 698936 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1736733320 877635 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150074&oldid=150025 5* 03ClearLimediWater 5* (+386) 10/* Hello, world! */
> 1736733567 151181 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150075&oldid=135613 5* 03Calculus is fun 5* (+526) 10Added MoreMathRPN example
> 1736733604 603789 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150076&oldid=150075 5* 03Calculus is fun 5* (-3) 10/* MoreMathRPN */
> 1736733647 71867 PRIVMSG #esolangs :14[[07Pi-alpha function14]]4 M10 02https://esolangs.org/w/index.php?diff=150077&oldid=150076 5* 03Calculus is fun 5* (-2) 10/* MoreMathRPN */
> 1736734163 895628 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150078&oldid=150074 5* 03ClearLimediWater 5* (+129) 10/* A+B Problem */
> 1736734199 256592 PRIVMSG #esolangs :14[[07Luke's Box Programming14]]4 M10 02https://esolangs.org/w/index.php?diff=150079&oldid=150073 5* 03ClearLimediWater 5* (-1) 10/* Commands */
> 1736734589 235154 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 10 02https://esolangs.org/w/index.php?diff=150080&oldid=150078 5* 03ClearLimediWater 5* (+260) 10/* Truth-machine */
> 1736734603 731785 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 M10 02https://esolangs.org/w/index.php?diff=150081&oldid=150070 5* 03TheCanon2 5* (+312) 10
> 1736736091 315295 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150082&oldid=134890 5* 03Calculus is fun 5* (+250) 10Added MoreMathRPN example
> 1736736112 374729 PRIVMSG #esolangs :14[[07Luke's Box Pseudocode14]]4 M10 02https://esolangs.org/w/index.php?diff=150083&oldid=150080 5* 03ClearLimediWater 5* (+45) 10/* Examples */
< 1736736568 946096 :ais523!~ais523@user/ais523 QUIT :Quit: quit
> 1736738362 639322 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150084&oldid=149470 5* 03Calculus is fun 5* (+82) 10Added MoreMathRPN example
> 1736740107 509956 PRIVMSG #esolangs :14[[07Never Gonna Give You Up14]]4 M10 02https://esolangs.org/w/index.php?diff=150085&oldid=145237 5* 03Calculus is fun 5* (+1184) 10Added MoreMathRPN example
> 1736740113 141420 PRIVMSG #esolangs :14[[07Mario Maker Calculator is not Turing-complete14]]4 M10 02https://esolangs.org/w/index.php?diff=150086&oldid=150081 5* 03TheCanon2 5* (+969) 10finished
< 1736742131 996775 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736742155 15533 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1736744322 449094 PRIVMSG #esolangs :14[[07$3COND14]]4 10 02https://esolangs.org/w/index.php?diff=150087&oldid=103153 5* 03BoundedBeans 5* (-1) 10Fix typo of "an"
> 1736744879 542215 PRIVMSG #esolangs :14[[07Drive-In Window JSON14]]4 10 02https://esolangs.org/w/index.php?diff=150088&oldid=129924 5* 03BoundedBeans 5* (+1) 10The backtick is reserved in namespaced IDs if it needs to be escaped
> 1736745007 942438 PRIVMSG #esolangs :14[[07Drive-In Window JSON14]]4 10 02https://esolangs.org/w/index.php?diff=150089&oldid=150088 5* 03BoundedBeans 5* (-41) 10Fix some reserved character stuff
< 1736747842 151805 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs * :Claire Rodriguez
< 1736747885 363322 :yewscion_!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Read error: Connection reset by peer
> 1736750890 228395 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 10 02https://esolangs.org/w/index.php?diff=150090&oldid=150084 5* 03Ractangle 5* (-1) 10/* Implementations */
< 1736751629 143929 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736753118 236092 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1736753502 144490 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Evening.
< 1736755098 636285 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736756445 630776 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1736757146 618719 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150091&oldid=150072 5* 03Ractangle 5* (+204) 10/* UHH */
< 1736762877 129645 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736763927 962016 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150092&oldid=150091 5* 03PkmnQ 5* (+234) 10
> 1736767316 2093 PRIVMSG #esolangs :14[[07CreativeASM14]]4 10 02https://esolangs.org/w/index.php?diff=150093&oldid=148709 5* 03MihaiEso 5* (-191) 10
> 1736767331 240501 PRIVMSG #esolangs :14[[07CreativeASM14]]4 10 02https://esolangs.org/w/index.php?diff=150094&oldid=150093 5* 03MihaiEso 5* (-23) 10
> 1736767520 902483 PRIVMSG #esolangs :14[[07CreativeASM/Assembler/Old Versions14]]4 10 02https://esolangs.org/w/index.php?diff=150095&oldid=136136 5* 03MihaiEso 5* (+8) 10
> 1736769426 882319 PRIVMSG #esolangs :14[[07CreativeASM/Examples14]]4 10 02https://esolangs.org/w/index.php?diff=150096&oldid=136138 5* 03MihaiEso 5* (+5671) 10
> 1736769491 396502 PRIVMSG #esolangs :14[[07Never Gonna Give You Up14]]4 10 02https://esolangs.org/w/index.php?diff=150097&oldid=150085 5* 03MihaiEso 5* (+73) 10
> 1736769579 513599 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150098&oldid=149932 5* 03Buckets 5* (+12) 10
> 1736769587 24866 PRIVMSG #esolangs :14[[07User talk:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150099&oldid=150022 5* 03ClearLimediWater 5* (+118) 10
> 1736769680 576517 PRIVMSG #esolangs :14[[07Chops14]]4 N10 02https://esolangs.org/w/index.php?oldid=150100 5* 03Buckets 5* (+2454) 10Created page with "Chops is an esoteric language where it's instructions are variable, dependent on the previous ASCII character created by [[User:Buckets]], created to fill the purpose of "What if I just made an esolang, so that It's hard enough to look like garbage, but easy to make a mac
< 1736769813 135044 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736770001 814517 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736772163 457002 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736775992 217444 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1736776222 377039 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs * :Claire Rodriguez
< 1736776392 98171 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 265 seconds
> 1736778989 657603 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150101&oldid=150069 5* 03Jan jelo 5* (+203) 10/* Unlambda */
> 1736779061 83280 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150102&oldid=150101 5* 03Jan jelo 5* (-1) 10/* Unlambda */
> 1736779477 918375 PRIVMSG #esolangs :14[[07Unlambda14]]4 10 02https://esolangs.org/w/index.php?diff=150103&oldid=147426 5* 03Jan jelo 5* (+244) 10/* Examples */
< 1736779936 613669 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736781344 280520 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=150104&oldid=149903 5* 03Blashyrkh 5* (+238) 10/* Programs */
> 1736782101 109936 PRIVMSG #esolangs :14[[07BytePusher14]]4 10 02https://esolangs.org/w/index.php?diff=150105&oldid=150104 5* 03Blashyrkh 5* (-27) 10/* Programs */
< 1736782243 275036 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 252 seconds
< 1736782243 311592 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 252 seconds
< 1736782250 53904 :moony!moony@hellomouse/dev/moony QUIT :Ping timeout: 265 seconds
< 1736783016 677139 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736783303 499008 :moony!moony@hellomouse/dev/moony JOIN #esolangs moony :Kaylie! (she/her)
< 1736783343 433292 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736783386 424729 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736783406 677468 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736783416 217796 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736783918 521787 :molson!~molson@2605-4A80-2101-99D0-6F3C-C8E-3717-10C4-dynamic.midco.net JOIN #esolangs molson :realname
< 1736784097 397952 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736784115 2902 :molson_!~molson@2605:4a80:2101:99d0:8de:e28f:63e9:ef27 QUIT :Ping timeout: 260 seconds
> 1736786135 540597 PRIVMSG #esolangs :14[[07A+B Problem14]]4 M10 02https://esolangs.org/w/index.php?diff=150106&oldid=147179 5* 03Calculus is fun 5* (+431) 10Added MoreMathRPN example
< 1736787369 928053 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736787423 411550 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736787522 280419 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 10 02https://esolangs.org/w/index.php?diff=150107&oldid=149926 5* 03Calculus is fun 5* (+369) 10Added links of examples on other pages
> 1736788920 495364 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150108&oldid=150082 5* 03Blashyrkh 5* (+2263) 10/* Examples */ FizzBuzz implementation in Lazy K
< 1736790513 883580 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736792011 304731 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736792604 659502 PRIVMSG #esolangs :14[[07Curse14]]4 M10 02https://esolangs.org/w/index.php?diff=150109&oldid=69669 5* 03Jan jelo 5* (+28) 10/* Bijective Pair Function */
< 1736793470 912729 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736793473 54647 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 265 seconds
< 1736793552 561785 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736794082 738220 PRIVMSG #esolangs :14[[07202514]]4 10 02https://esolangs.org/w/index.php?diff=150110&oldid=130286 5* 0347 5* (+0) 10/* Interpreter */
> 1736794277 670582 PRIVMSG #esolangs :14[[07Shape-Machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150111&oldid=150090 5* 03Calculus is fun 5* (+0) 10/* External resources */
> 1736796750 63733 PRIVMSG #esolangs :14[[07Half hearted14]]4 N10 02https://esolangs.org/w/index.php?oldid=150112 5* 03Calculus is fun 5* (+1050) 10Added Half hearted program form
< 1736799414 633952 :chomwitt_mobile!~alex@2a02:587:7a09:1500:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 244 seconds
< 1736799766 823472 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1736806045 349680 PRIVMSG #esolangs :14[[07AGG14]]4 10 02https://esolangs.org/w/index.php?diff=150113&oldid=122949 5* 03Mmph 5* (+81) 10
> 1736806168 984849 PRIVMSG #esolangs :14[[07AGG14]]4 M10 02https://esolangs.org/w/index.php?diff=150114&oldid=150113 5* 03Mmph 5* (+32) 10
> 1736806242 762631 PRIVMSG #esolangs :14[[07User:Brain Boy 5314]]4 M10 02https://esolangs.org/w/index.php?diff=150115&oldid=130540 5* 03Brain Boy 53 5* (+27) 10
< 1736806451 831826 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736806720 740661 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736806814 226751 PRIVMSG #esolangs :14[[07NoError14]]4 10 02https://esolangs.org/w/index.php?diff=150116&oldid=132109 5* 03Brain Boy 53 5* (+1) 10
> 1736807256 54558 PRIVMSG #esolangs :14[[07Malbolge Reborn14]]4 10 02https://esolangs.org/w/index.php?diff=150117&oldid=131441 5* 03Brain Boy 53 5* (+18) 10
< 1736807765 807790 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1736808767 109428 PRIVMSG #esolangs :14[[07Malbolge Reborn14]]4 M10 02https://esolangs.org/w/index.php?diff=150118&oldid=150117 5* 03Brain Boy 53 5* (+36) 10
> 1736809487 493902 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03WinslowJosiah 5*  10New user account
< 1736809986 36222 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736812306 679679 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736812978 34819 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736813171 130997 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736814506 747735 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736814551 330691 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736818468 678743 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736818964 502618 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :Ping timeout: 260 seconds
< 1736818974 991369 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :Ping timeout: 260 seconds
< 1736820022 977323 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736820028 984533 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736821251 915415 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736821704 458497 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736822387 307199 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736822875 459594 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1736824201 564043 :Sgeo!~Sgeo@user/sgeo QUIT :*.net *.split
< 1736824202 493417 :op_4!~tslil@user/op-4/x-9116473 QUIT :*.net *.split
< 1736824202 923402 :fowl!~fowl@user/fowl QUIT :*.net *.split
< 1736824202 961619 :Hooloovoo!~Hooloovoo@hax0rbana.org QUIT :*.net *.split
< 1736824204 76977 :lynndotpy6!~rootcanal@134.122.123.70 QUIT :*.net *.split
< 1736824204 583455 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :*.net *.split
< 1736824204 815476 :sprout!~sprout@84-80-106-227.fixed.kpn.net QUIT :*.net *.split
< 1736824501 763969 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736824501 819352 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4
< 1736824501 819441 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736824501 819494 :Hooloovoo!~Hooloovoo@hax0rbana.org JOIN #esolangs hooloovoo :Hooloovoo
< 1736824501 819529 :lynndotpy6!~rootcanal@134.122.123.70 JOIN #esolangs lynndotpy :lynn
< 1736824501 819573 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736824501 819614 :sprout!~sprout@84-80-106-227.fixed.kpn.net JOIN #esolangs sprout :sprout
< 1736824610 658761 :craigo!~craigo@user/craigo QUIT :Quit: Leaving
< 1736825253 214384 :Everything!~Everythin@195.138.86.118 QUIT :Ping timeout: 252 seconds
> 1736827868 311844 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 N10 02https://esolangs.org/w/index.php?oldid=150119 5* 03Jan jelo 5* (+2102) 10Created page with "This is a [[Underload]] interpreter in scheme by [[User:Jan jelo]]. 
 (define(init program)  (list(string->list program)       '())) (define(program state)  (list-ref state 0)) (define(stack state)  (list-ref state 1)) ;a (define(a state) 
> 1736827991 266293 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150120&oldid=150062 5* 03Jan jelo 5* (+39) 10/* Intepreters */
> 1736829533 843585 PRIVMSG #esolangs :14[[07PDAsephtwo14]]4 N10 02https://esolangs.org/w/index.php?oldid=150121 5* 03BoundedBeans 5* (+16102) 10Created page with "PDAseptwo is an extension of [[PDAsephone]] by [[User:BoundedBeans]], made in January 2025.  ==Storage== PDAsephone normally has two stacks, a stack of characters and a stack of instances of [[push-down automata]]. Each push-down automaton has a stack of charac
> 1736829580 379559 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150122&oldid=150098 5* 03BoundedBeans 5* (+17) 10
> 1736829661 1323 PRIVMSG #esolangs :14[[07User:BoundedBeans14]]4 10 02https://esolangs.org/w/index.php?diff=150123&oldid=148989 5* 03BoundedBeans 5* (+108) 10
> 1736829670 718213 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 10 02https://esolangs.org/w/index.php?diff=150124&oldid=150119 5* 03Jan jelo 5* (+1) 10
> 1736830083 379718 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150125&oldid=127692 5* 03BoundedBeans 5* (+0) 10Wrong fingerprint name
> 1736830462 937894 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150126&oldid=150125 5* 03BoundedBeans 5* (+162) 10Additional operations to GRPH
> 1736830553 731458 PRIVMSG #esolangs :14[[07User:BoundedBeans/My Funge-98 fingerprints14]]4 10 02https://esolangs.org/w/index.php?diff=150127&oldid=150126 5* 03BoundedBeans 5* (+55) 10Hyperbolic functions in GRPH
> 1736831521 844043 PRIVMSG #esolangs :14[[07Testeee14]]4 N10 02https://esolangs.org/w/index.php?oldid=150128 5* 03BestCoder 5* (+176) 10Created page with "hello i am really cool"
> 1736831534 75871 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150129&oldid=150128 5* 03BestCoder 5* (+1) 10
> 1736831544 173909 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150130&oldid=150129 5* 03BestCoder 5* (-2) 10
> 1736831556 583322 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150131&oldid=150130 5* 03BestCoder 5* (+0) 10
> 1736831566 371482 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150132&oldid=150131 5* 03BestCoder 5* (+0) 10
> 1736831576 36906 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150133&oldid=150132 5* 03BestCoder 5* (+0) 10
> 1736831585 966094 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150134&oldid=150133 5* 03BestCoder 5* (+0) 10
> 1736831594 847432 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150135&oldid=150134 5* 03BestCoder 5* (+0) 10
> 1736831603 304200 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150136&oldid=150135 5* 03BestCoder 5* (+0) 10
> 1736831634 505390 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150137&oldid=150136 5* 03BestCoder 5* (+0) 10
> 1736831643 126002 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150138&oldid=150137 5* 03BestCoder 5* (+0) 10
> 1736831661 989016 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150139&oldid=150138 5* 03BestCoder 5* (-2) 10
> 1736831669 644634 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150140&oldid=150139 5* 03BestCoder 5* (+2) 10
> 1736831679 430976 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150141&oldid=150140 5* 03BestCoder 5* (-2) 10
> 1736831700 519369 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150142&oldid=150141 5* 03BestCoder 5* (+15) 10
> 1736831718 969839 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150143&oldid=150142 5* 03BestCoder 5* (+16) 10
> 1736831728 226783 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150144&oldid=150143 5* 03BestCoder 5* (+1) 10
> 1736831740 339599 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150145&oldid=150144 5* 03BestCoder 5* (+2) 10
> 1736831760 978397 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150146&oldid=150145 5* 03BestCoder 5* (+9) 10
> 1736831796 385530 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150147&oldid=150146 5* 03BestCoder 5* (+41) 10
> 1736831820 592732 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150148&oldid=150147 5* 03BestCoder 5* (+19) 10
> 1736831834 789455 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150149&oldid=150148 5* 03BestCoder 5* (+0) 10
> 1736831854 337093 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150150&oldid=150149 5* 03BestCoder 5* (+12) 10
> 1736831864 78683 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150151&oldid=150150 5* 03BestCoder 5* (+2) 10
> 1736831891 858102 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150152&oldid=150151 5* 03BestCoder 5* (+23) 10
> 1736831903 362732 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150153&oldid=150152 5* 03BestCoder 5* (-2) 10
> 1736831921 178524 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150154&oldid=150153 5* 03BestCoder 5* (+16) 10
> 1736831934 802167 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150155&oldid=150154 5* 03BestCoder 5* (+77) 10
> 1736831956 911579 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150156&oldid=150155 5* 03BestCoder 5* (+336) 10
> 1736832039 124322 PRIVMSG #esolangs :14[[07Talk:Burn14]]4 10 02https://esolangs.org/w/index.php?diff=150157&oldid=150092 5* 03BestCoder 5* (+30) 10/* UHH */
> 1736832155 625024 PRIVMSG #esolangs :14[[07Tictactoe14]]4 10 02https://esolangs.org/w/index.php?diff=150158&oldid=149441 5* 03BestCoder 5* (-9) 10
> 1736832291 941769 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150159&oldid=150156 5* 03BestCoder 5* (+99) 10
> 1736832305 549012 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150160&oldid=150159 5* 03BestCoder 5* (+8) 10
> 1736832337 179629 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150161&oldid=150160 5* 03BestCoder 5* (+1) 10
> 1736832364 815788 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150162&oldid=150161 5* 03BestCoder 5* (+428) 10
> 1736832378 768394 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150163&oldid=150162 5* 03BestCoder 5* (-536) 10
> 1736832391 305431 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150164&oldid=150163 5* 03BestCoder 5* (-40) 10
> 1736832399 536940 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150165&oldid=150164 5* 03BestCoder 5* (-22) 10
> 1736832415 366766 PRIVMSG #esolangs :14[[07Testeee14]]4 10 02https://esolangs.org/w/index.php?diff=150166&oldid=150165 5* 03BestCoder 5* (-217) 10
> 1736838780 229108 PRIVMSG #esolangs :14[[07Special:Log/delete14]]4 delete10 02 5* 03Ais523 5*  10deleted "[[02Testeee10]]": offtopic (not an esolang)
< 1736839029 684350 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736843108 253366 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736846916 453908 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 246 seconds
> 1736847039 5824 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Piet; 5*  10New user account
> 1736847378 2559 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150167&oldid=150060 5* 03Piet; 5* (+158) 10
< 1736848017 863466 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1736848264 479088 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1736848558 123648 :APic!apic@apic.name PRIVMSG #esolangs :Hi
> 1736853176 967239 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150168&oldid=150063 5* 03MihaiEso 5* (+164) 10
< 1736854048 427646 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1736856149 240278 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736856331 823292 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736857079 905611 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736857456 999106 :chomwitt_mobile!~alex@ppp-94-67-201-217.home.otenet.gr JOIN #esolangs chomwitt :realname
< 1736857566 517635 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736857697 632691 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736857740 631516 PRIVMSG #esolangs :14[[07Beunfunge14]]4 N10 02https://esolangs.org/w/index.php?oldid=150169 5* 03None1 5* (+265) 10Created page with "'''Beunfunge''' is an esolang invented by [[User:None1]]. It is [[Befunge]], but there's no self modifying. ==Examples== Many examples in Befunge work in Beunfunge too, but some do not. [[Category:Two-dimensional languages]] [[Category:Languages]] [[Category:2025]]"
> 1736858584 760448 PRIVMSG #esolangs :14[[07User:Thalassohora14]]4 10 02https://esolangs.org/w/index.php?diff=150170&oldid=115547 5* 03Thalassohora 5* (-134) 10
< 1736858856 826618 :chomwitt_mobile!~alex@ppp-94-67-201-217.home.otenet.gr QUIT :Remote host closed the connection
> 1736860184 618040 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 10 02https://esolangs.org/w/index.php?diff=150171&oldid=149330 5* 03Jan jelo 5* (+1251) 10/* Examples */
> 1736860214 479379 PRIVMSG #esolangs :14[[07Pyline Classic14]]4 M10 02https://esolangs.org/w/index.php?diff=150172&oldid=150171 5* 03Jan jelo 5* (+2) 10
< 1736860983 718011 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736862630 263460 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1736862993 836735 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150173&oldid=148099 5* 03I am islptng 5* (+580) 10/* desmos */ new section
< 1736863045 179691 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu JOIN #esolangs b_jonas :[https://web.libera.chat] wib_jonas
< 1736863057 22158 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :`olist 1317
< 1736863061 219258 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :olist : shachaf oerjan Sgeo boily nortti b_jonas Noisytoot
< 1736863063 474701 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu PRIVMSG #esolangs :I think that might be my fastest olist yet
< 1736865349 377056 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba PRIVMSG #esolangs :Does anyone know an algorithm to calculate the nash equilibrium percentage of a big matrix?  The kind of equilibrium where the matrix contains scores of something in the row vs something in the column, and the equilibrium is x% percent of the first row, y% of the second row, z% of the third row, etc, which gives everything exactly the same score.
< 1736865392 426841 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Read error: Connection reset by peer
< 1736865445 22078 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba PRIVMSG #esolangs :Google is just showing me how to find the equilibrium in 2x2 matrices, so I'm wondering if what I'm looking for has another name.
< 1736867024 184484 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu QUIT :Quit: Client closed
< 1736868075 184182 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu JOIN #esolangs b_jonas :[https://web.libera.chat] wib_jonas
< 1736868210 281443 :fowl!~fowl@user/fowl QUIT :Quit: Ping timeout (120 seconds)
< 1736868242 97460 :fowl!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736869224 114520 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736869230 178958 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736869372 173576 :int-e!~noone@int-e.eu PRIVMSG #esolangs :impomatic: If it's a zero sum game, there's a linear programming formulation for that; https://en.wikipedia.org/wiki/Zero-sum_game#Solving ... otherwise it'http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
< 1736869411 365153 :int-e!~noone@int-e.eu PRIVMSG #esolangs :...otherwise it's something called PPAD-complete that I have not yet understood, http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
< 1736869433 246889 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(gotta love fat-fingering '- )
< 1736869536 119427 :int-e!~noone@int-e.eu PRIVMSG #esolangs :impomatic: in any case that's what I guess your question was, so hopefully that's good for some alternative keywords.
< 1736869681 303799 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Beautiful. Firefox is blocking http links returned by https://html.duckduckgo.com/html/ because they are a "Potential security risk".
< 1736870112 427339 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
> 1736870138 991245 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150174&oldid=150173 5* 03Ractangle 5* (+200) 10/* desmos */
> 1736870745 769961 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150175&oldid=150174 5* 03I am islptng 5* (+645) 10
< 1736871640 676605 :wib_jonas!~wib_jonas@business-37-191-60-209.business.broadband.hu QUIT :Ping timeout: 240 seconds
< 1736873098 66932 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736873920 493691 PRIVMSG #esolangs :14[[07User talk:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150176&oldid=150175 5* 03Jan jelo 5* (+202) 10/* desmos */
< 1736874834 964814 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :PPAD-complete is more-or-less FNP-complete, FWIW; we haven't proven it yet, but there's piles of evidence and my prior is at something like 97%.
< 1736874870 638149 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :IOW free markets probably are not efficient; there are probably cases where a free market can't avoid sitting exponentially far from Nash equilibrium for exponentially long.
< 1736874922 448060 :int-e!~noone@int-e.eu PRIVMSG #esolangs :you mean on top of all the other things that are obviously going wrong with that theory?
< 1736874929 447509 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(rational agents, lol)
< 1736874953 861171 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Of course, yeah. (Personally I'm still waiting for a categorical formulation of markets; absent one, I'm not convinced that they have a nice algebraic theory.)
< 1736875136 310832 :int-e!~noone@int-e.eu PRIVMSG #esolangs :korvo: what exactly is FNP? f(x) = y can be verified in polynomial time?
< 1736875150 388264 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(I can look it up if the answer is no)
< 1736875175 987257 :int-e!~noone@int-e.eu PRIVMSG #esolangs :(I guess I could look it up regardless :-P)
< 1736875194 237664 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :int-e: I think there's a couple equivalent formulations. I think of it as a generalization of ♯NP; it's like NP but all problems are valued in nats instead of Booleans.
< 1736875292 284861 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :But we can take any countable domain, I think, so that we can have functions M -> {R} from markets to computable sets of computable reals. And that would formalize Nash equilibria, given a formalization of markets.
< 1736875315 208095 :int-e!~noone@int-e.eu PRIVMSG #esolangs :hah, of course "FNP class" does not eliminate the "family nurse practitioner" false positive ;) ("complexity" did the trick)
< 1736875394 789195 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :In this case, the part that's quick to verify is a function R × M -> 2 which checks that a particular market valuation is Nash by checking that each market participant doesn't have any better options; the part that's expensive is computing the history of the market's evolution.
< 1736875446 847046 :int-e!~noone@int-e.eu PRIVMSG #esolangs :Hmm not sure I see the #NP (model counting) connection.
< 1736875540 349256 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Nash equilibria aren't unique; there's multiple possible histories which converge.
< 1736875598 327999 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I mean, FNP doesn't count.
< 1736875617 451597 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, sure. It's more general than that.
< 1736875657 193767 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I mean, yes, I'm wrong; I'm just saying that I think of function problems as generalized counting of decision problems.
< 1736875670 767579 :int-e!~noone@int-e.eu PRIVMSG #esolangs :I guess you can ask how many solutions there are and then it becomes #NP, more or less.
< 1736876402 97852 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs : /query hackeso 
< 1736876404 22413 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :uh
< 1736876631 49482 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :https://complexityzoo.net/Complexity_Zoo:F#fnp doesn't seem to say that there's such a thing as FNP-completeness
< 1736877118 316902 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Aaronson omits many things, but yeah, it could well be the case that there's no such notion of completeness under reductions.
< 1736877163 229059 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :do you know what kind of reduction this needs?
< 1736877172 318698 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Note that there's no such notion of PPAD-completeness either. It happens to be the case that the problem of finding Nash equilibria is complete for PPAD, but I'm not sure if there's a nice category PPADC of such problems or if Nash is a special case.
< 1736877194 10603 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :different reductions can result in different notions of completness I think
< 1736877219 577251 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :but maybe it's obvious in this case
< 1736877219 825974 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :I imagine it's the same sort of reduction as in NP-completeness: a computable poly-time rewrite of the input problem. I'd guess that we also need a contravariant computable poly-time adapter for the output, so that we can transform the outputs from one problem to another too.
< 1736877245 647636 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Oh, yes, for sure. For example the category NPC is specifically about computable poly-time reductions.
< 1736877400 268664 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :and like sometimes you want to allow multiple calls to an oracle
< 1736877467 628711 :int-e!~noone@int-e.eu PRIVMSG #esolangs :korvo: you might have to poly-time manipulate the output too?
< 1736877592 17145 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :ooh, this may be relevant: https://complexityzoo.net/Complexity_Zoo_References#dgp05
< 1736877674 528436 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :C. Daskalakis, P. W. Goldberg, and C. H. Papadimitriou "The Complexity of Computing a Nash Equilibrium", SIAM J. Comput. 39(1):195-259, 2009. doi:10.1137/070699652 Originally appeared in STOC 2006, Author's website conference version "https://people.csail.mit.edu/costis/simplified.pdf" . 
< 1736877763 873716 :int-e!~noone@int-e.eu PRIVMSG #esolangs :yeah the PDF I linked above is a follow-up for that work (well, an earlier technical report version of it)
< 1736877805 232139 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :int-e: Yeah. Like, imagine each function problem is a general arrow I -> O in some category. To transform it to X -> Y, we need both X -> I and also O -> Y, with the latter contravariant. This doesn't matter for NPC because everything is X -> 2 there.
< 1736877813 682726 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :oh good
< 1736878127 720915 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736878137 422860 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com PRIVMSG #esolangs :Thanks int-e
< 1736878196 117110 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com QUIT :Client Quit
< 1736879404 658436 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736879480 40185 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736879900 421880 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736879972 912431 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 272 seconds
< 1736880057 671096 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1736880075 670753 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1736880627 660028 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150177&oldid=150108 5* 03Jan jelo 5* (+947) 10/* Examples */
> 1736880893 429786 PRIVMSG #esolangs :14[[07Muriel14]]4 10 02https://esolangs.org/w/index.php?diff=150178&oldid=149501 5* 03Jan jelo 5* (+955) 10/* Examples */
> 1736880954 149360 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150179&oldid=150178 5* 03Jan jelo 5* (+4) 10/* 99 bottles of beer */
> 1736880997 947756 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150180&oldid=150179 5* 03Jan jelo 5* (+5) 10/* Hello, world! */
> 1736882863 712567 PRIVMSG #esolangs :14[[07Just14]]4 10 02https://esolangs.org/w/index.php?diff=150181&oldid=150059 5* 0347 5* (-12) 10
< 1736885615 122022 :int-e!~noone@int-e.eu QUIT :Remote host closed the connection
< 1736885653 270170 :int-e!~noone@int-e.eu JOIN #esolangs int-e :Bertram
< 1736885690 987728 :lambdabot!~lambdabot@haskell/bot/lambdabot QUIT :Remote host closed the connection
< 1736885787 568670 :lambdabot!~lambdabot@haskell/bot/lambdabot JOIN #esolangs lambdabot :Lambda_Robots:_100%_Loyal
> 1736885946 214379 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150182&oldid=149983 5* 03Ractangle 5* (+437) 10/* Syntax */
> 1736886011 750019 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150183&oldid=150182 5* 03Ractangle 5* (+0) 10the r is lowercase
< 1736886261 110434 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736886261 167719 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
> 1736886662 517790 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150184&oldid=150183 5* 03Ractangle 5* (+7) 10/* The IMP */
< 1736887645 32541 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1736888587 904638 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150185&oldid=150177 5* 03Jan jelo 5* (-6) 10/* Muriel */
> 1736888675 473225 PRIVMSG #esolangs :14[[07Muriel14]]4 M10 02https://esolangs.org/w/index.php?diff=150186&oldid=150180 5* 03Jan jelo 5* (-5) 10/* FizzBuzz */
> 1736888847 182360 PRIVMSG #esolangs :14[[07Muriel/compile from minsky machine14]]4 M10 02https://esolangs.org/w/index.php?diff=150187&oldid=149232 5* 03Jan jelo 5* (+4) 10
> 1736889428 715684 PRIVMSG #esolangs :14[[07Underload/a interpreter in scheme14]]4 M10 02https://esolangs.org/w/index.php?diff=150188&oldid=150124 5* 03Jan jelo 5* (+212) 10
> 1736890244 632786 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 N10 02https://esolangs.org/w/index.php?oldid=150189 5* 03FluixMakesEsolangs 5* (+1133) 10Initial version of this page
> 1736890282 458143 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 M10 02https://esolangs.org/w/index.php?diff=150190&oldid=150189 5* 03FluixMakesEsolangs 5* (+6) 10Fixed grammer error
> 1736890313 349361 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 10 02https://esolangs.org/w/index.php?diff=150191&oldid=150190 5* 03FluixMakesEsolangs 5* (-96) 10
> 1736890360 71967 PRIVMSG #esolangs :14[[07NumbersPlusWhat14]]4 M10 02https://esolangs.org/w/index.php?diff=150192&oldid=150191 5* 03FluixMakesEsolangs 5* (+34) 10fixed some stuff
> 1736893419 809504 PRIVMSG #esolangs :14[[07Beunfunge14]]4 M10 02https://esolangs.org/w/index.php?diff=150193&oldid=150169 5* 03Aadenboy 5* (+9) 10stub
< 1736893954 242259 :lisbeths!uid135845@id-135845.lymington.irccloud.com JOIN #esolangs lisbeths :lisbeths
< 1736894940 378998 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736896169 380166 :fowl0!~fowl@user/fowl JOIN #esolangs fowl :fowl
< 1736896195 955248 :fowl!~fowl@user/fowl QUIT :Read error: Connection reset by peer
< 1736896196 365014 :fowl0!~fowl@user/fowl NICK :fowl
< 1736897674 20208 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736899410 100579 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 265 seconds
< 1736899416 477615 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1736899460 510921 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
< 1736899510 106096 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736899980 307477 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736900910 306113 :APic!apic@apic.name PRIVMSG #esolangs :Night
< 1736901099 289882 :ais523!~ais523@user/ais523 PRIVMSG #esolangs :night
< 1736901172 818586 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Night.
< 1736902310 381775 :lisbeths!uid135845@id-135845.lymington.irccloud.com QUIT :Quit: Connection closed for inactivity
< 1736907690 44386 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1736907769 615227 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736910338 323797 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736910511 946690 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736910530 375076 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1736910599 537753 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736911045 735413 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection
< 1736911076 121948 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1736911372 922409 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection
< 1736912417 515662 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
> 1736922493 195115 PRIVMSG #esolangs :14[[07BitTurn14]]4 N10 02https://esolangs.org/w/index.php?oldid=150194 5* 03I am islptng 5* (+477) 10Created page with "BitTurn is an esolang that operates on a 2D bitmap. The pointer can read/write the bits on the map and move.  ==Commands== {|class=wikitable ! Command !! Meaning |- | | || Flip the current bit pointing and move forward. |- |  1736926936 521416 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150195&oldid=146885 5* 0347 5* (-67) 10
> 1736927158 645107 PRIVMSG #esolangs :14[[07BIX Queue Subset14]]4 10 02https://esolangs.org/w/index.php?diff=150196&oldid=132672 5* 0347 5* (+22) 10/* See also */
> 1736927293 324358 PRIVMSG #esolangs :14[[07Brainmaker14]]4 10 02https://esolangs.org/w/index.php?diff=150197&oldid=73046 5* 0347 5* (+23) 10/* Interpreters */
> 1736927498 997519 PRIVMSG #esolangs :14[[07Number factory14]]4 10 02https://esolangs.org/w/index.php?diff=150198&oldid=130968 5* 03Piet; 5* (+49) 10
> 1736927533 422728 PRIVMSG #esolangs :14[[07Number Factory14]]4 10 02https://esolangs.org/w/index.php?diff=150199&oldid=71656 5* 03Piet; 5* (+49) 10
< 1736928365 570394 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736930676 391269 :craigo!~craigo@user/craigo QUIT :Remote host closed the connection
> 1736934238 998790 PRIVMSG #esolangs :14[[07StackedDeck14]]4 N10 02https://esolangs.org/w/index.php?oldid=150200 5* 03Ashli Katt 5* (+6746) 10Create page for StackedDeck, specification incomplete temporarily.
> 1736934708 374884 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150201&oldid=150200 5* 03Ashli Katt 5* (-1) 10/* Execution */
> 1736935189 586110 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150202&oldid=150201 5* 03Ashli Katt 5* (+0) 10/* Card Execution */
< 1736936425 963489 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1736941549 479307 PRIVMSG #esolangs :14[[07Talk:Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150203&oldid=150051 5* 03PrySigneToFry 5* (+1244) 10
< 1736942107 188160 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736942107 224495 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
> 1736942357 285773 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 N10 02https://esolangs.org/w/index.php?oldid=150204 5* 03PrySigneToFry 5* (+2130) 10Created page with "1. Take that [[Translated /Mihai Again!|]]. 
  ** ** ** ** ** ..."
> 1736942433 784353 PRIVMSG #esolangs :14[[07Translated /Mihai Again!14]]4 10 02https://esolangs.org/w/index.php?diff=150205&oldid=150168 5* 03PrySigneToFry 5* (+64) 10
< 1736942591 64151 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 265 seconds
< 1736942726 220725 :int-e!~noone@int-e.eu PRIVMSG #esolangs :`? password
< 1736942730 298155 :HackEso!~h@techne.zem.fi PRIVMSG #esolangs :password The password of the month is not from a jedi.
< 1736942781 14282 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736943578 708225 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :Quit: Lost terminal
> 1736948642 642927 PRIVMSG #esolangs :14[[07User:Gilbert189/Iternary14]]4 10 02https://esolangs.org/w/index.php?diff=150206&oldid=140378 5* 03Gilbert189 5* (+1658) 10
> 1736948660 478575 PRIVMSG #esolangs :14[[07User:Gilbert189/A way to golf Baba is You esolangs14]]4 10 02https://esolangs.org/w/index.php?diff=150207&oldid=129056 5* 03Gilbert189 5* (+20) 10added WRITE and BOOM
< 1736951282 639087 :APic!apic@apic.name PRIVMSG #esolangs :Hi
> 1736951376 646572 PRIVMSG #esolangs :14[[07User:Unname479814]]4 10 02https://esolangs.org/w/index.php?diff=150208&oldid=149016 5* 03Unname4798 5* (+160) 10
> 1736951399 716190 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150209&oldid=150208 5* 03Unname4798 5* (+7) 10
> 1736951415 844438 PRIVMSG #esolangs :14[[07User:Unname479814]]4 M10 02https://esolangs.org/w/index.php?diff=150210&oldid=150209 5* 03Unname4798 5* (+0) 10
< 1736951783 263540 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1736952537 675520 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1736953537 861495 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 M10 02https://esolangs.org/w/index.php?diff=150211&oldid=150185 5* 03Jan jelo 5* (+29) 10/* TeX */
< 1736953680 382517 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs * :realname
< 1736954260 643248 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Ping timeout: 240 seconds
< 1736955515 181940 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
< 1736955515 258549 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 252 seconds
< 1736955899 677018 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736956057 489589 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1736956074 719205 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1736956978 669345 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
> 1736959528 119670 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150212&oldid=142604 5* 03Jan jelo 5* (+469) 10/* Sample programs */
> 1736959566 230328 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150213&oldid=150212 5* 03Jan jelo 5* (+1) 10/* Sample programs */
> 1736960016 687921 PRIVMSG #esolangs :14[[07++===14]]4 N10 02https://esolangs.org/w/index.php?oldid=150214 5* 03PkmnQ 5* (+1414) 10Created page with "[[++===]] is a register-based [[OISC]] with no branching. The name is a concatenation of ++, ==, and =, describing the singular instruction (if (*A++ == *B) *A = *C;).  == Specification == Memory in [[
> 1736960650 315041 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150215&oldid=150213 5* 03Jan jelo 5* (+0) 10/* Sample programs */
< 1736963070 483654 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1736963437 935676 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150216&oldid=150167 5* 03WinslowJosiah 5* (+141) 10
> 1736963471 741510 PRIVMSG #esolangs :14[[07Bespoke14]]4 N10 02https://esolangs.org/w/index.php?oldid=150217 5* 03WinslowJosiah 5* (+10960) 10Created page with "'''Bespoke''' is an [[esoteric programming language]] created in 2025 by Josiah Winslow. It encodes instructions into the lengths of words, similarly to his earlier esolang [[Poetic (esolang)|Poetic]]. Programs can tend to look like abstract poetry, although a se
< 1736964474 982345 :b_jonas!~x@88.87.242.184 JOIN #esolangs * :b_jonas
< 1736965092 434928 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :you know how in Windows, if you want to enter a unicode code point of which you know the code, you can open either WordPad or Word, enter the number in hexadecimal, then press alt+X, right? Now I was told that some future version of Windows might not include WordPad by default. Sounds bad, right? How will you enter arbitrary code points without installing additional software. Nope, actually TIL that 
< 1736965098 611154 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :Windows 11's version of Notepad supports this too, so no need to use Wordpad for this on Windows 11 machines.
< 1736965214 662909 :iovoid!iovoid@hellomouse/dev/iovoid QUIT :*.net *.split
< 1736965214 700687 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator QUIT :*.net *.split
< 1736965215 527494 :Artea!~Lufia@artea.pt QUIT :*.net *.split
< 1736965216 998036 :MizMahem!sid296354@user/mizmahem QUIT :*.net *.split
< 1736965217 822878 :myname!~myname@v2202404221793264578.bestsrv.de QUIT :*.net *.split
< 1736965344 55527 :iovoid!iovoid@hellomouse/dev/iovoid JOIN #esolangs iovoid :∃x: some(iovoid) * x ∉ iovoid
< 1736965344 136144 :Bowserinator!Bowserinat@hellomouse/dev/bowserinator JOIN #esolangs Bowserinator :No VPS :(
< 1736965344 136206 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
< 1736965344 136237 :MizMahem!sid296354@user/mizmahem JOIN #esolangs MizMahem :🐍🐔
< 1736965344 136245 :myname!~myname@v2202404221793264578.bestsrv.de JOIN #esolangs myname :myname
< 1736965347 408737 :Artea!~Lufia@artea.pt QUIT :Max SendQ exceeded
< 1736966121 106562 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736966121 144391 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1736966336 544225 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1736966367 311393 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 244 seconds
< 1736966513 337239 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
< 1736966617 878674 :Artea!~Lufia@artea.pt JOIN #esolangs Artea :Artea ElFo
< 1736967926 918741 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
> 1736968328 465160 PRIVMSG #esolangs :14[[07User:Aadenboy/Ultimate warsides14]]4 N10 02https://esolangs.org/w/index.php?oldid=150218 5* 03Aadenboy 5* (+6081) 10ULTIMATE WARSIDES.
> 1736968689 254681 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150219&oldid=149919 5* 03Aadenboy 5* (+38) 10add [[User:Aadenboy/Ultimate warsides]]
> 1736971800 200560 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150220&oldid=150184 5* 03Ractangle 5* (+0) 10/* The IMP */
< 1736972853 106265 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736972853 187651 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Ping timeout: 248 seconds
< 1736976134 777641 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1736978342 46948 :mtm_!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1736978450 42112 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 248 seconds
< 1736980329 429364 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca QUIT :Ping timeout: 246 seconds
> 1736980721 667639 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150221&oldid=150211 5* 03Jan jelo 5* (+2494) 10/* Thue */
< 1736980787 806979 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1736981047 328721 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca JOIN #esolangs zzo38 :zzo38
> 1736981793 964463 PRIVMSG #esolangs :14[[07User:Jan jelo/FizzBuzz in Thue14]]4 N10 02https://esolangs.org/w/index.php?oldid=150222 5* 03Jan jelo 5* (+2569) 10Created page with "This is a [[FizzBuzz]] program in [[Thue]] by [[User: Jan jelo]]. Outputs are separated by ;. 
 o0::=~0 o1::=~1 o2::=~2 o3::=~3 o4::=~4 o5::=~5 o6::=~6 o7::=~7 o8::=~8 o9::=~9  0[<0]::=0[3>] 1[<0]::=[<1]1 2[<0]::=2[3>] 3[<0]::=3[
< 1736982438 795291 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1736982546 440693 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736982724 210372 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :The podcast "Future of Coding" is updating again! Their recent episode is about whether the universe is a computer. https://futureofcoding.org/episodes/074
< 1736983031 521784 :molson_!~molson@2605-4A80-2101-99D0-4EAD-E7D9-1255-7D90-dynamic.midco.net JOIN #esolangs molson :realname
< 1736983269 381500 :molson!~molson@2605-4A80-2101-99D0-6F3C-C8E-3717-10C4-dynamic.midco.net QUIT :Ping timeout: 276 seconds
> 1736984056 267646 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150223&oldid=150120 5* 03Jan jelo 5* (+36) 10/* Other */
< 1736985365 399859 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736985531 473315 :yewscion_!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Ping timeout: 276 seconds
< 1736985765 496714 :mtm_!~textual@47.202.75.129 QUIT :Ping timeout: 276 seconds
< 1736985978 618011 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1736992201 658107 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736992771 555142 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Quit: Leaving
< 1736992792 405832 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736992801 362264 :ming__!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Remote host closed the connection
< 1736992854 603133 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net JOIN #esolangs yewscion :Claire Rodriguez
< 1736993079 144730 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1736995446 940860 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1736997380 422738 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1736997643 361668 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1736998754 741926 PRIVMSG #esolangs :14[[07Trajedy14]]4 10 02https://esolangs.org/w/index.php?diff=150224&oldid=52419 5* 03Jafetish 5* (+5) 10/* Implementation */ update URL
> 1737000574 985360 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 10 02https://esolangs.org/w/index.php?diff=150225&oldid=150064 5* 03Piet; 5* (+271) 10/* Bespoke */
< 1737000741 434151 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 276 seconds
< 1737001027 816837 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1737002031 627970 PRIVMSG #esolangs :14[[07++===14]]4 10 02https://esolangs.org/w/index.php?diff=150226&oldid=150214 5* 03PkmnQ 5* (+88) 10/* Specification */
< 1737002668 270396 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 244 seconds
< 1737005390 418913 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737007605 670885 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :
< 1737008689 304179 :craigo!~craigo@user/craigo QUIT :Read error: Connection reset by peer
< 1737008707 441392 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737009133 940897 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737009396 410239 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737010649 32870 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737010776 68306 :Sgeo_!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737011002 71906 :Sgeo!~Sgeo@user/sgeo QUIT :Ping timeout: 265 seconds
< 1737012760 747132 :Sgeo_!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737012908 967390 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737012909 4947 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd JOIN #esolangs chomwitt :realname
< 1737012919 496908 :ProofTechnique_!sid79547@id-79547.ilkley.irccloud.com QUIT :*.net *.split
< 1737013237 547079 :ProofTechnique_!sid79547@id-79547.ilkley.irccloud.com JOIN #esolangs * :ptech
< 1737013906 68706 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737015976 354548 :chomwitt_alt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
< 1737015976 554139 :chomwitt!~alex@2a02:587:7a22:8c00:42b0:76ff:fe46:a5fd QUIT :Remote host closed the connection
< 1737018150 434322 :craigo!~craigo@user/craigo QUIT :Ping timeout: 246 seconds
> 1737019175 391827 PRIVMSG #esolangs :14[[07Print("Hello, World!")14]]4 10 02https://esolangs.org/w/index.php?diff=150227&oldid=148535 5* 03Piet; 5* (+95) 10/* Python */
> 1737019658 680022 PRIVMSG #esolangs :14[[07Print("Hello, World!")14]]4 M10 02https://esolangs.org/w/index.php?diff=150228&oldid=150227 5* 03Piet; 5* (+7) 10
< 1737022968 562421 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737023083 431823 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737023218 508289 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737023329 967908 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737023355 661897 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737027594 519736 PRIVMSG #esolangs :14[[07Beunfunge14]]4 10 02https://esolangs.org/w/index.php?diff=150229&oldid=150193 5* 03None1 5* (+123) 10
> 1737027766 624873 PRIVMSG #esolangs :14[[07Cardinal14]]4 10 02https://esolangs.org/w/index.php?diff=150230&oldid=62320 5* 03Piet; 5* (+25134) 10/* Rule 110 */ Possibly Turing-complete
> 1737027867 978543 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150231&oldid=150204 5* 03PrySigneToFry 5* (+417) 10
> 1737028030 888530 PRIVMSG #esolangs :14[[07Talk:Cardinal14]]4 N10 02https://esolangs.org/w/index.php?oldid=150232 5* 03Piet; 5* (+230) 10Proof of Turing-completeness
> 1737028146 712929 PRIVMSG #esolangs :14[[07User talk:PrySigneToFry14]]4 10 02https://esolangs.org/w/index.php?diff=150233&oldid=150011 5* 03Piet; 5* (+214) 10/* Is Cardinal Turing-complete? */ new section
> 1737028399 179430 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150234&oldid=150231 5* 03PrySigneToFry 5* (+986) 10
> 1737028726 927123 PRIVMSG #esolangs :14[[07Talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150235&oldid=150052 5* 03PrySigneToFry 5* (+374) 10
> 1737028945 607064 PRIVMSG #esolangs :14[[07PrySigneToFry-complete14]]4 10 02https://esolangs.org/w/index.php?diff=150236&oldid=149883 5* 03PrySigneToFry 5* (+385) 10
< 1737029061 248163 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737029144 731568 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737030523 819984 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737033376 47563 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150237&oldid=150122 5* 03None1 5* (+16) 10/* B */
< 1737033680 95141 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 265 seconds
< 1737034505 499448 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
> 1737034802 287441 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=150238&oldid=149712 5* 03None1 5* (+51) 10/* My Esolangs */
< 1737035523 909088 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737035752 597685 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737039217 372506 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737039847 920060 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737040112 428949 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737040596 480629 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737042245 935712 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737042918 328428 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737043475 439693 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737044339 674322 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737044466 414273 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737047544 434039 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737047604 831758 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737049023 453211 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
< 1737049106 974042 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737049618 129377 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737050645 437619 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Shannarra 5*  10New user account
> 1737050886 185011 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150239&oldid=150216 5* 03Shannarra 5* (+125) 10/* Introductions */
< 1737050970 952781 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737051071 434516 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737051310 73996 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150240&oldid=150237 5* 03Shannarra 5* (+15) 10/* S */
> 1737052409 395289 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150241&oldid=150221 5* 03Blashyrkh 5* (+2420) 10/* Lazy K */ Another (a bit shorter) version of FizzBuzz written in Lazy K
> 1737052573 738634 PRIVMSG #esolangs :14[[07FizzBuzz14]]4 10 02https://esolangs.org/w/index.php?diff=150242&oldid=150241 5* 03Blashyrkh 5* (+9) 10/* Lazy K */
> 1737052658 661451 PRIVMSG #esolangs :14[[07Sapphire14]]4 N10 02https://esolangs.org/w/index.php?oldid=150243 5* 03Shannarra 5* (+1545) 10Sapphire - Ruby's evil twin language.
> 1737052681 695803 PRIVMSG #esolangs :14[[07Sapphire14]]4 10 02https://esolangs.org/w/index.php?diff=150244&oldid=150243 5* 03Shannarra 5* (-5) 10
< 1737052800 89434 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737052845 457525 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 276 seconds
< 1737052880 620739 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737053805 564438 PRIVMSG #esolangs :14[[07Church numeral14]]4 M10 02https://esolangs.org/w/index.php?diff=150245&oldid=149108 5* 03Jan jelo 5* (+0) 10/* Arithmetic */
< 1737054956 463620 :yewscion!~yewscion@c-73-236-134-241.hsd1.pa.comcast.net QUIT :Ping timeout: 252 seconds
< 1737055389 143869 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737055408 209815 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150246&oldid=150240 5* 03WinslowJosiah 5* (+14) 10Add Bespoke
> 1737055568 51429 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (B-C)14]]4 10 02https://esolangs.org/w/index.php?diff=150247&oldid=148318 5* 03WinslowJosiah 5* (+378) 10Add Hello World in Bespoke
> 1737056187 73828 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150248&oldid=150102 5* 03Jan jelo 5* (+162) 10/* Examples */
> 1737056412 828494 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150249&oldid=139532 5* 03Blashyrkh 5* (+262) 10/* Merely an encoding */
> 1737057608 812863 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150250&oldid=150249 5* 03Blashyrkh 5* (+10) 10/* Merely an encoding */
> 1737060440 989080 PRIVMSG #esolangs :14[[07Propositio14]]4 M10 02https://esolangs.org/w/index.php?diff=150251&oldid=147380 5* 03 5* (+2) 10Fixed syntax
> 1737061279 434231 PRIVMSG #esolangs :14[[07Closuretalk14]]4 M10 02https://esolangs.org/w/index.php?diff=150252&oldid=149203 5* 03Rdococ 5* (-100) 10/* Conclusion */
> 1737061459 843553 PRIVMSG #esolangs :14[[07Talk:Binary lambda calculus14]]4 10 02https://esolangs.org/w/index.php?diff=150253&oldid=150250 5* 03Ais523 5* (+491) 10/* Merely an encoding */ a matter of perspective
< 1737062312 939509 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
> 1737063102 374583 PRIVMSG #esolangs :14[[07CContains14]]4 N10 02https://esolangs.org/w/index.php?oldid=150254 5* 03 5* (+848) 10Started page
> 1737063111 741201 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150255&oldid=148127 5* 03Ractangle 5* (-21) 10/* Syntax */
> 1737063343 635481 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150256&oldid=150255 5* 03Ractangle 5* (-148) 10/* Cat program */
> 1737063390 880981 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150257&oldid=150256 5* 03Ractangle 5* (-4) 10/* Cat program */
> 1737063492 413805 PRIVMSG #esolangs :14[[07MarkupL14]]4 10 02https://esolangs.org/w/index.php?diff=150258&oldid=150257 5* 03Ractangle 5* (-92) 10
> 1737063673 126676 PRIVMSG #esolangs :14[[07User:Ractangle/Sandbox14]]4 10 02https://esolangs.org/w/index.php?diff=150259&oldid=149995 5* 03Ractangle 5* (-16) 10/* Stuff to continue */
> 1737063701 284898 PRIVMSG #esolangs :14[[07User:Ractangle14]]4 10 02https://esolangs.org/w/index.php?diff=150260&oldid=149987 5* 03Ractangle 5* (+16) 10/* Esolangs */
> 1737063811 774097 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150261&oldid=149860 5* 03Ractangle 5* (+62) 10/* Commands */
> 1737063872 451823 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150262&oldid=150261 5* 03Ractangle 5* (+34) 10/* Truth-machine */
> 1737063895 461766 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150263&oldid=150262 5* 03Ractangle 5* (-1) 10/* Truth-machine */
> 1737063916 31014 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150264&oldid=150263 5* 03Ractangle 5* (-1) 10/* Commands */
< 1737064010 307168 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737064120 736701 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150265&oldid=150264 5* 03Ractangle 5* (-75) 10/* Commands */
> 1737064221 180547 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150266&oldid=150265 5* 03Ractangle 5* (-32) 10/* Infinite Loop */
> 1737064302 937839 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150267&oldid=150266 5* 03Ractangle 5* (+1) 10/* Infinite Loop */
> 1737064966 201301 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150268&oldid=150267 5* 03Ractangle 5* (+259) 10/* Examples */
> 1737064996 717784 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150269&oldid=150268 5* 03Ractangle 5* (+3) 10/* Hello world */
> 1737065267 77627 PRIVMSG #esolangs :14[[07Postrado14]]4 10 02https://esolangs.org/w/index.php?diff=150270&oldid=150269 5* 03Ractangle 5* (+2) 10/* Truth-machine */
< 1737065443 744805 :impomatic!~impomatic@2a00:23c7:5fc9:5401:34ff:71f7:d545:7aba QUIT :Quit: Client closed
> 1737066173 509946 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=150271&oldid=149882 5* 03Calculus is fun 5* (+20) 10Added People Category
> 1737066369 838475 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=150272&oldid=149244 5* 03Jan jelo 5* (+298) 10
< 1737066641 298519 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737066651 263476 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150273&oldid=150107 5* 03Calculus is fun 5* (+43) 10/* Examples elsewhere on this site */
< 1737066894 15476 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
> 1737067211 573760 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150274&oldid=150219 5* 03Aadenboy 5* (+21) 10zzzzzzzz whatever people category jumpscare
> 1737069030 517380 PRIVMSG #esolangs :14[[07User:FluixMakesEsolangs14]]4 N10 02https://esolangs.org/w/index.php?oldid=150275 5* 03FluixMakesEsolangs 5* (+143) 10Initial version of this page
< 1737069280 882596 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737070864 121193 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737071606 940251 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737071667 340480 :mtm_!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1737071696 512428 :mtm!~textual@47.202.75.129 QUIT :Read error: Connection reset by peer
> 1737074313 61099 PRIVMSG #esolangs :14[[07Talk:///14]]4 10 02https://esolangs.org/w/index.php?diff=150276&oldid=150272 5* 03Jan jelo 5* (-298) 10
< 1737080730 265107 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737082930 561239 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737084282 474986 :ais523!~ais523@user/ais523 QUIT :Ping timeout: 252 seconds
< 1737084916 62228 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737084970 53303 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737086977 641340 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150277&oldid=150234 5* 03PrySigneToFry 5* (+31) 10
> 1737087811 118994 PRIVMSG #esolangs :14[[07StackedDeck14]]4 10 02https://esolangs.org/w/index.php?diff=150278&oldid=150202 5* 03Ashli Katt 5* (+529) 10Describe the Discard Pile and Sleeve
> 1737089699 991070 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150279&oldid=150278 5* 03Ashli Katt 5* (+611) 10Fill in some card effects
< 1737091273 536196 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737092608 938930 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737093428 270602 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737093787 383540 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737095783 840539 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737095939 973458 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737096312 785883 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737096572 729277 PRIVMSG #esolangs :14[[0714]]4 N10 02https://esolangs.org/w/index.php?oldid=150280 5* 03None1 5* (+1294) 10Created page with " is an esolang invented by [[User:None1]] that uses Chinese characters, what a Chinese character does depends on the radical of it.  It has a stack that stores unbounded signed integers ==Commands== {| class="wikitable" ! Radical !! Meaning !! Example of Chinese characters |- | 
> 1737096609 493300 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150281&oldid=150246 5* 03None1 5* (+13) 10/* Non-alphabetic */
> 1737096637 283050 PRIVMSG #esolangs :14[[07User:None114]]4 10 02https://esolangs.org/w/index.php?diff=150282&oldid=150238 5* 03None1 5* (+53) 10/* My Esolangs */
< 1737098068 147917 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737098599 19939 PRIVMSG #esolangs :14[[07Cardinal14]]4 M10 02https://esolangs.org/w/index.php?diff=150283&oldid=150230 5* 03Piet; 5* (+9) 10Link
< 1737101776 848786 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737102269 901047 :ais523!~ais523@user/ais523 QUIT :Quit: quit
< 1737103541 98697 :Melvar!~melvar@dslb-088-070-034-006.088.070.pools.vodafone-ip.de QUIT :Ping timeout: 248 seconds
< 1737103589 311098 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Read error: Connection reset by peer
< 1737103645 273509 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737105717 133753 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737106777 416596 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150284&oldid=149387 5* 03Jan jelo 5* (+1035) 10/* Tracing the ~ replacement code */
> 1737106806 408330 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150285&oldid=150284 5* 03Jan jelo 5* (+86) 10/* Tracing the ~ replacement code */
> 1737107710 293184 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150286&oldid=150067 5* 03PkmnQ 5* (+288) 10/* FALSE */
> 1737108031 493270 PRIVMSG #esolangs :14[[07AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150287&oldid=133992 5* 03Piet; 5* (+2550) 10This page has been marked as Turing complete for a long time without an explicit proof.
< 1737108842 866719 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737109683 816492 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150288&oldid=120354 5* 03Tomhe 5* (+129) 10/* External resources */ Add c2fj and bf2fj
> 1737109699 518291 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150289&oldid=150288 5* 03Tomhe 5* (-3) 10/* External resources */
> 1737109985 566419 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Tomhe 5*  10uploaded "[[02File:Prime sieve.gif10]]"
> 1737110255 834713 PRIVMSG #esolangs :14[[07FlipJump14]]4 M10 02https://esolangs.org/w/index.php?diff=150291&oldid=150289 5* 03Tomhe 5* (+1068) 10Add c2fj, add flipjump primes_sieve
< 1737110436 469090 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
> 1737110734 589677 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150292&oldid=145151 5* 03Ractangle 5* (+22) 10/* Syntax */
> 1737110749 730903 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150293&oldid=150292 5* 03Ractangle 5* (-1) 10/* Truth-machine */
< 1737113913 479835 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737114961 249516 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737114972 502981 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds
< 1737115148 62012 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737115203 644161 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
> 1737115710 585951 PRIVMSG #esolangs :14[[07X-script14]]4 N10 02https://esolangs.org/w/index.php?oldid=150294 5* 03PrySigneToFry 5* (+7705) 10Created page with "X-script is designed by PSTF.  = Language Overview = X-Script is a Turing-complete, efficient, lightweight and concise programming language. It combines the simplicity of Python, the power of JavaScript, the "hacking" of assembly language, and the efficiency of C
< 1737116483 242695 :Melvar!~melvar@dslb-088-070-034-244.088.070.pools.vodafone-ip.de JOIN #esolangs Melvar :melvar
> 1737117934 964802 PRIVMSG #esolangs :14[[07'Python' is not recognized14]]4 10 02https://esolangs.org/w/index.php?diff=150295&oldid=150293 5* 03Ractangle 5* (-2) 10/* Truth-machine */
> 1737120971 102283 PRIVMSG #esolangs :14[[07Talk:Underload14]]4 10 02https://esolangs.org/w/index.php?diff=150296&oldid=150285 5* 03Jan jelo 5* (+770) 10/* Tracing the ~ replacement code */
< 1737121542 945006 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737121803 101946 PRIVMSG #esolangs :14[[07AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150297&oldid=150287 5* 03Piet; 5* (-366) 10Shorter without exponent bug - I suddenly got a message about an IP-ban that has actually been expired, so I have to borrow my friend's computer
> 1737125310 346760 PRIVMSG #esolangs :14[[07CContains14]]4 10 02https://esolangs.org/w/index.php?diff=150298&oldid=150254 5* 03 5* (+373) 10Linked to self and added commands
> 1737125387 162536 PRIVMSG #esolangs :14[[07User talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150299&oldid=147382 5* 03 5* (+18) 10
< 1737125842 43808 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
< 1737127169 484448 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
> 1737127949 891237 PRIVMSG #esolangs :14[[07User talk:14]]4 10 02https://esolangs.org/w/index.php?diff=150300&oldid=150299 5* 03 5* (-347) 10Removed ULTRAESOLANG (i've given up)
> 1737128765 13905 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03H33T33 5*  10New user account
< 1737131043 678066 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737134020 642525 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Ping timeout: 240 seconds
< 1737135722 677224 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737136298 120828 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737136603 676999 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737136958 156958 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737137045 709586 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net JOIN #esolangs * :[https://web.libera.chat] DOS_User_webchat
< 1737138057 746920 :DOS_User_webchat!~DOS_User_@20.red-81-33-54.dynamicip.rima-tde.net QUIT :Remote host closed the connection
< 1737139269 62033 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 265 seconds
< 1737139319 211856 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737139347 156977 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Remote host closed the connection
< 1737139349 138881 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737140020 655504 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1737140639 431816 PRIVMSG #esolangs :14[[07Language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150301&oldid=150281 5* 03Buckets 5* (+12) 10
> 1737140666 945689 PRIVMSG #esolangs :14[[07Sipes14]]4 N10 02https://esolangs.org/w/index.php?oldid=150302 5* 03Buckets 5* (+867) 10Created page with "Sipes is an esoteric language found in an old Notebook created by  [[User:Buckets]] in 2019,  [[User:Buckets]] has Completely forgotton the Instructions and Commands, The only Insight was It wad created April 13th 2019, A note saying 'The interpretir can be 33 toothpicks, 
> 1737140749 482438 PRIVMSG #esolangs :14[[07Sipes14]]4 M10 02https://esolangs.org/w/index.php?diff=150303&oldid=150302 5* 03Buckets 5* (+1) 10
> 1737140966 423550 PRIVMSG #esolangs :14[[07Bespoke14]]4 10 02https://esolangs.org/w/index.php?diff=150304&oldid=150217 5* 03WinslowJosiah 5* (+0) 10Fix error with H STOREVALUE docs
> 1737141085 373518 PRIVMSG #esolangs :14[[07User:Buckets14]]4 N10 02https://esolangs.org/w/index.php?oldid=150305 5* 03Buckets 5* (+41) 10Created page with "The Creator of *[[Chops]] and *[[Sipes]]."
> 1737144049 686667 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150306&oldid=150220 5* 0347 5* (+291) 10/* Syntax */
> 1737144302 155435 PRIVMSG #esolangs :14[[07CContains14]]4 10 02https://esolangs.org/w/index.php?diff=150307&oldid=150298 5* 03 5* (+1508) 10Added Container Code segment and a few more commands.
> 1737144413 304326 PRIVMSG #esolangs :14[[07Switch gr14]]4 10 02https://esolangs.org/w/index.php?diff=150308&oldid=150306 5* 0347 5* (+378) 10
< 1737145838 871677 :impomatic!~impomatic@host86-162-113-0.range86-162.btcentralplus.com QUIT :Quit: Client closed
< 1737146462 993692 :b_jonas!~x@88.87.242.184 PRIVMSG #esolangs :we must remember to choose some phrase related to Terry Pratchett to use as the password for 2025-03.
< 1737149426 911407 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
> 1737152050 551069 PRIVMSG #esolangs :14[[07Talk:14]]4 N10 02https://esolangs.org/w/index.php?oldid=150309 5* 03Aadenboy 5* (+361) 10Created page with "this reminds me of my esolang, [[Kawa]], with the character radical aspect ~~~~"
> 1737152144 796029 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150310&oldid=150280 5* 03Aadenboy 5* (+4) 10/* XKCD Random Number */ shouldn't there be a zero on the stack first?
< 1737153724 141288 :zzo38!~zzo38@host-24-207-52-143.public.eastlink.ca PRIVMSG #esolangs :What are the query parameters for pagination in GitHub and what are the parameters for sending a new issue and a comment of a issue?
< 1737154117 760461 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737154704 181090 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737155152 981859 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737155545 79926 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737156837 149861 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737157247 167112 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1737157260 528379 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1737157283 733225 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737158567 211604 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Quit: ZNC 1.9.1 - https://znc.in
< 1737158626 593941 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
> 1737159535 386126 PRIVMSG #esolangs :14[[07StackedDeck14]]4 M10 02https://esolangs.org/w/index.php?diff=150311&oldid=150279 5* 03Ashli Katt 5* (+72) 10Clarify discard pile order
< 1737159974 430157 :SGautam!uid286066@id-286066.ilkley.irccloud.com JOIN #esolangs SGautam :Siddharth Gautam
< 1737160958 949223 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737161741 923126 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
< 1737162126 113250 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname
< 1737163535 363038 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737163664 45152 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150312&oldid=150310 5* 03PrySigneToFry 5* (+42) 10
> 1737163801 207076 PRIVMSG #esolangs :14[[07Language list14]]4 10 02https://esolangs.org/w/index.php?diff=150313&oldid=150301 5* 03PrySigneToFry 5* (+15) 10/* X */
< 1737163933 944458 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737163959 69318 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737164064 881336 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150314&oldid=150312 5* 03PrySigneToFry 5* (+895) 10
< 1737164574 368577 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737164601 188766 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737164659 115151 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737164685 48839 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737164937 720769 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150315&oldid=150294 5* 03PrySigneToFry 5* (+505) 10
> 1737165038 747588 PRIVMSG #esolangs :14[[07Translated SLet14]]4 10 02https://esolangs.org/w/index.php?diff=150316&oldid=146568 5* 03PrySigneToFry 5* (+9) 10
< 1737167276 183785 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737167304 166798 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737167354 319700 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737168486 725382 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150317&oldid=150314 5* 03YufangTSTSU 5* (-8) 10i sink  belongs to 
> 1737168683 86762 PRIVMSG #esolangs :14[[07X-script14]]4 10 02https://esolangs.org/w/index.php?diff=150318&oldid=150315 5* 03PrySigneToFry 5* (+1218) 10
> 1737169299 389041 PRIVMSG #esolangs :14[[07User:Jan jelo/BF interpreter in Thue14]]4 N10 02https://esolangs.org/w/index.php?oldid=150319 5* 03Jan jelo 5* (+4668) 10Created page with "This is a [[Brainfuck]] interpreter in [[Thue]] by [[User:Jan jelo]]  (input and output are unary numbers(each output wrapped by ( and )),the value of each cell is an unbounded natural number) 
 {0>}+::=+{0>} {
> 1737169507 353536 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150320&oldid=150215 5* 03Jan jelo 5* (+43) 10/* External resources */
< 1737170736 80103 :SGautam!uid286066@id-286066.ilkley.irccloud.com QUIT :Quit: Connection closed for inactivity
> 1737171387 649286 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150321&oldid=149942 5* 03PrySigneToFry 5* (+1110) 10/* Make it even   scarier !!!! */ new section
> 1737171468 299149 PRIVMSG #esolangs :14[[07Bespoke14]]4 10 02https://esolangs.org/w/index.php?diff=150322&oldid=150304 5* 03WinslowJosiah 5* (+141) 10Update instructions list to reflect CONTROL OTHERWISE
> 1737171530 478885 PRIVMSG #esolangs :14[[07User talk:MihaiEso14]]4 10 02https://esolangs.org/w/index.php?diff=150323&oldid=150321 5* 03PrySigneToFry 5* (+107) 10
< 1737171640 895889 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737172158 786352 PRIVMSG #esolangs :14[[07Hello world program in esoteric languages (nonalphabetic and A)14]]4 10 02https://esolangs.org/w/index.php?diff=150324&oldid=144394 5* 03PrySigneToFry 5* (+272) 10/*  */
< 1737172511 793503 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172540 84369 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172574 777562 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172600 76812 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172606 512600 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172672 94649 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737172675 777650 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737172752 54913 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737173619 363587 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737174683 525753 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5*  10uploaded "[[02File:KawaDiacriticSwap.png10]]": Ring
> 1737174701 187199 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150326&oldid=149864 5* 03Aadenboy 5* (+135) 10new command
< 1737176353 925411 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737176431 924620 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737177293 568443 PRIVMSG #esolangs :14[[07(-)14]]4 N10 02https://esolangs.org/w/index.php?oldid=150327 5* 03Yayimhere2(school) 5* (+1000) 10Created page with "{{wrongtitle|title=<->}} '''<->''' is an esolang about swapping text == syntax == an expression is evaluated right from left * -"''x''""''y''" swaps the order of string x and string y * <"''x''" delete the < and return an expression where its "''x''""''x''" so fo
> 1737177376 329960 PRIVMSG #esolangs :14[[07(-)14]]4 10 02https://esolangs.org/w/index.php?diff=150328&oldid=150327 5* 03Yayimhere2(school) 5* (+90) 10
< 1737177503 901000 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737177542 519032 PRIVMSG #esolangs :14[[07(-)14]]4 10 02https://esolangs.org/w/index.php?diff=150329&oldid=150328 5* 03Yayimhere2(school) 5* (+17) 10/* syntax */
< 1737177579 976274 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737178355 906064 PRIVMSG #esolangs :14[[07Funciton14]]4 M10 02https://esolangs.org/w/index.php?diff=150330&oldid=141686 5* 03Timwi 5* (+21) 10
> 1737180622 849060 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150331&oldid=150317 5* 03YufangTSTSU 5* (+493) 10
> 1737181244 897457 PRIVMSG #esolangs :14[[07Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;14]]4 N10 02https://esolangs.org/w/index.php?oldid=150332 5* 03Yayimhere2(school) 5* (+289) 10Created page with "this makes no sense and also isn't Turing complete cuz its impossible to run the brainfuck code on the website. its also uncomputable cuz access isn't described well enough @~~~~"
< 1737183150 665945 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za JOIN #esolangs * :[https://web.libera.chat] yayimhere
< 1737183372 815943 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :i had this idea. we're the commands only are "unlocked" by using other commands. like where you need to use commands and then it unlocks a new command and so on. but is this really possible and could this be made interesting?
< 1737183789 329952 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Sure. For example, in Python, the command `math.sin()` is "unlocked" by `import math`.
< 1737184363 222032 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true(though its not interesting or really a gimmick)
< 1737184639 577335 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :There are systems called "spellservers". In a spellserver, the way to "unlock" a command is with a cryptographic key or something else that's similarly hard to get.
> 1737184667 370123 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150333&oldid=150331 5* 03YufangTSTSU 5* (+280) 10
< 1737184673 488386 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Brian Warner's writeup is still great; he describes what are known as Warner-style spellservers: https://www.lothar.com/blog/58-The-Spellserver/
< 1737184738 656753 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :welp seems its already done
< 1737184740 42308 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :sad
< 1737184826 998928 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :time to come up with a new idea
< 1737184957 580717 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Is that really all you care about?
< 1737184985 883191 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185040 996531 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :ive had comments that my esolangs are unoriginal
< 1737185060 88384 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :so im trying to make smth that unique
< 1737185062 973676 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185069 398385 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185146 944443 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185148 526328 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :for once
< 1737185153 319150 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :dang its hard tho
< 1737185248 799719 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Well, yeah. Nothing's really unique or original, right? Everything we make is built from prior designs.
< 1737185286 33989 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true
< 1737185296 298710 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :but at least make smth slightly unique
< 1737185296 558717 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :You know those stories about Mozart or other child geniuses? They're usually exaggerated. Here's one common exaggeration: Mozart didn't actually write any of the melodies that he's credited with as a child.
< 1737185309 710486 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :lol
< 1737185346 331210 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :No, really. Or, in English, we have the legend of Shakespeare. But Shakespeare didn't actually write any of the plots to his stories; he borrowed them from other stories.
< 1737185346 391846 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :makes sense they are
< 1737185353 485098 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :never heard of them tho
< 1737185357 667327 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :(Or much more recently, Disney.)
< 1737185373 761604 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :well Disney is Disney lol
< 1737185391 807690 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :this reminds me of that one doctor who book series
< 1737185400 497511 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :thats literally just stolen plots
< 1737185401 519666 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :well
< 1737185405 163468 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :not really
< 1737185415 18920 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :its like the point of it
< 1737185465 225549 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :anywayn that gave me an idea/concept
< 1737185490 197381 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :a esolang where the programs kinda steal contents from each other
< 1737185493 42869 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185502 312465 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :like if one program solves smth
< 1737185510 286191 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :then another could steal that result
< 1737185517 100343 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :but you don't have control over it
< 1737185546 963593 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Sure, go for it.
< 1737185569 437114 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185581 996219 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :FWIW actually *building* a spellserver is non-trivial. Note that Warner doesn't actually give one, nor explain its details; he just says that if somebody implements a language like E, then they could probably try to write a spellserver too.
< 1737185593 57757 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :is there anything like this? or slightly like it(this is more to get insperation, and help cuz I have no idea how to do it))
< 1737185616 692675 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185647 915430 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :https://github.com/monte-language/typhon/blob/master/mast/tools/spellserver.mt.md Anyway, I implemented a language like E, and then I wrote a spellserver.
< 1737185668 265570 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :yayimhere: This is why int-e and I push you to learn to code; actually *implementing the idea* is what is hard and impressive. Anybody can have ideas.
< 1737185681 137431 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :true
< 1737185686 436542 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :btw im learning prolog:O
< 1737185689 16589 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :*:)
< 1737185693 394932 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737185706 982513 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :lol i typoed it to a :O
< 1737185707 483090 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :me dum dum lol'
< 1737185712 168970 :korvo!~korvo@2604:a880:4:1d0::4d6:d000 PRIVMSG #esolangs :Fun! I'm glad that you're learning.
< 1737185731 611891 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :afterwards its minikanren and then lisp
< 1737185756 267172 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737185815 883002 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :my concentration is constantly stolen from v leaving and coming back to the server wow
< 1737185831 154395 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737185852 343079 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150334&oldid=150333 5* 03PrySigneToFry 5* (+217) 10
> 1737185905 317743 PRIVMSG #esolangs :14[[0714]]4 10 02https://esolangs.org/w/index.php?diff=150335&oldid=150334 5* 03PrySigneToFry 5* (+29) 10
< 1737185928 911328 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za PRIVMSG #esolangs :anyway bye
< 1737185932 328115 :yayimhere!~yayimhere@vc-nat-gp-s-41-13-18-132.umts.vodacom.co.za QUIT :Quit: Client closed
< 1737186002 261215 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186078 151996 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186155 381505 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186232 157640 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186233 977826 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186312 192488 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737186321 13551 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737186397 951360 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187246 583957 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737187318 943139 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187396 72818 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187405 700884 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187481 100828 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187481 437551 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187557 66448 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187603 214231 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187680 677596 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187682 823466 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187759 650732 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187762 212409 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187839 690900 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187839 960327 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187916 624602 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737187922 75414 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737187999 701240 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737188061 589378 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737188078 382388 PRIVMSG #esolangs :14[[07Talk:Semi-serious language list14]]4 N10 02https://esolangs.org/w/index.php?oldid=150336 5* 03Yayimhere2(school) 5* (+205) 10Created page with "tbh this with the number of restraints should be called the "ultra serious" lang list... @~~~~"
< 1737188137 649993 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737188409 293495 PRIVMSG #esolangs :14[[07AsciiDots14]]4 M10 02https://esolangs.org/w/index.php?diff=150337&oldid=150297 5* 03Piet; 5* (+68) 10Credits
< 1737188788 940263 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737188864 69225 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737188873 302130 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189029 119688 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189069 131281 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189145 141623 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189197 258845 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189272 71528 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737189334 997563 PRIVMSG #esolangs :14[[07Talk:AsciiDots14]]4 10 02https://esolangs.org/w/index.php?diff=150338&oldid=134806 5* 03Piet; 5* (+303) 10Bug
< 1737189375 111864 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189450 53333 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189520 578383 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189596 198465 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189649 67793 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189728 282935 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189788 169743 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189860 832020 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737189863 987976 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737189891 847664 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737189968 107720 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190131 805168 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190204 994324 :Guest9464!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737190265 328888 :Guest9464!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737190340 410596 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190352 13628 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190366 554042 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737190446 486879 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190461 984140 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190537 988829 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190557 436328 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190634 911237 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190644 413240 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737190720 41876 PRIVMSG #esolangs :14[[0714]]4 M10 02https://esolangs.org/w/index.php?diff=150339&oldid=150335 5* 03YufangTSTSU 5* (+0) 10please check nop please check nop please check nop please check nop
< 1737190720 987461 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190769 434660 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190845 396863 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737190895 904055 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737190972 388569 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191023 296027 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191104 704531 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191107 18015 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191183 464837 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191198 56414 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191273 399089 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191312 204398 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191388 932235 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191435 728989 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191511 908965 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191587 150815 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191662 929762 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737191670 341146 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737191746 513248 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
> 1737192096 299733 PRIVMSG #esolangs :14[[07User:UrnEn/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=150340&oldid=148603 5* 03UrnEn 5* (+6325) 10
< 1737192573 785440 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192650 66004 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192657 377246 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192732 84440 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192736 357257 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192812 60896 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737192915 172264 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737192991 58372 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193494 260597 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193570 17050 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193570 741260 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193646 979865 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193647 861559 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193723 783301 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193781 251082 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193863 825312 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737193864 409483 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737193937 121785 :Guest8686!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737194400 797947 :Guest8686!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737194477 387565 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194488 164282 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194561 983527 :Guest3889!~v@anomalous.eu JOIN #esolangs * :Wie?
< 1737194595 841998 :Guest3889!~v@anomalous.eu QUIT :Remote host closed the connection
< 1737194679 870550 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194683 84870 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194759 607443 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194763 907413 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194844 63384 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194845 534561 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737194924 39410 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737194994 40223 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195070 683624 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195116 526735 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195192 654112 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195199 309356 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195275 144793 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195281 343885 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195365 513464 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195394 490991 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737195471 688659 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737195478 171384 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
> 1737197480 665107 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 N10 02https://esolangs.org/w/index.php?oldid=150341 5* 03Piet; 5* (+181) 10Heard this just now
< 1737198897 940563 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer
> 1737199407 796920 PRIVMSG #esolangs :14[[07Semi-serious language list14]]4 10 02https://esolangs.org/w/index.php?diff=150342&oldid=149826 5* 03None1 5* (+10) 10/* Non-alphabetic */
< 1737199513 136812 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown
< 1737202129 391808 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737202451 69188 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737206790 475549 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737208447 611199 :APic!apic@apic.name PRIVMSG #esolangs :Hi
< 1737209174 424158 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737210037 64722 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210042 318857 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210204 286635 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210210 82104 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210293 80817 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210301 326991 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210382 77672 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210395 76704 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210631 65930 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210634 821395 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210672 485199 :m5zs7k!aquares@web10.mydevil.net QUIT :Ping timeout: 252 seconds
< 1737210751 60695 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210754 382940 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210833 85652 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210833 704395 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210915 294578 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737210922 998437 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737210947 469205 :m5zs7k!aquares@web10.mydevil.net JOIN #esolangs m5zs7k :m5zs7k
< 1737211007 891117 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211008 953866 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737211086 235647 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211089 968498 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737211360 448428 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
< 1737211524 19945 :mtm_!~textual@47.202.75.129 QUIT :Ping timeout: 245 seconds
< 1737211909 7444 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737211910 300284 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737214303 138353 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname
< 1737215651 129416 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737217354 94169 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737217683 926721 :V!~v@ircpuzzles/2022/april/winner/V JOIN #esolangs V :Wie?
< 1737217705 54243 :V!~v@ircpuzzles/2022/april/winner/V QUIT :Remote host closed the connection
< 1737218328 675642 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737218491 298379 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Client Quit
< 1737218645 648939 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
< 1737220627 781648 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737222082 23055 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150343&oldid=150286 5* 03PkmnQ 5* (+317) 10/* Examples */ Add Binary lambda calculus
< 1737222237 880558 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737222736 479938 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737223230 186870 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737225697 197113 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 252 seconds
< 1737225700 666269 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord
< 1737225880 694569 :Lord_of_Life_!~Lord@user/lord-of-life/x-2819915 NICK :Lord_of_Life
> 1737227233 439001 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150344&oldid=150326 5* 03Aadenboy 5* (+72) 10/* Example Programs */
< 1737227285 105652 :craigo!~craigo@user/craigo QUIT :Ping timeout: 248 seconds
> 1737227621 858483 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5*  10uploaded a new version of "[[02File:KawaFibonacci.png10]]": split into two lines, update to match newer changers
> 1737227680 607604 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5*  10uploaded a new version of "[[02File:KawaHelloWorld.png10]]": split into three lines
> 1737227804 61076 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 N10 02https://esolangs.org/w/index.php?oldid=150347 5* 03Aadenboy 5* (+1417) 10raw programs
> 1737227896 402226 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5*  10uploaded a new version of "[[02File:KawaJumps.png10]]": diacritic indicators
> 1737227923 73180 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150349&oldid=150344 5* 03Aadenboy 5* (+18) 10/* Bases */
> 1737228010 760422 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5*  10uploaded "[[02File:KawaDiacriticFlags.png10]]": All the flag diacritics
> 1737228018 691620 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150351&oldid=150349 5* 03Aadenboy 5* (+54) 10/* Diacritics */ flags
> 1737228084 358279 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 overwrite10 02 5* 03Aadenboy 5*  10uploaded a new version of "[[02File:KawaTruthMachine.png10]]": add flag
< 1737231818 113968 :molson!~molson@2605-4A80-2101-99D0-2336-79DF-71EA-5489-dynamic.midco.net JOIN #esolangs molson :realname
< 1737232069 411524 :molson_!~molson@2605-4A80-2101-99D0-4EAD-E7D9-1255-7D90-dynamic.midco.net QUIT :Ping timeout: 260 seconds
< 1737232538 112904 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1737232785 32851 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
> 1737233910 628892 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5*  10uploaded "[[02File:KawaBrainfuckImplementation.png10]]": [[Brainfuck]] implemented in [[Kawa]]
> 1737233995 754134 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150354&oldid=150351 5* 03Aadenboy 5* (+165) 10/* Example Programs */ implemented [[brainfuck]]
> 1737234009 480781 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150355&oldid=150354 5* 03Aadenboy 5* (+1) 10/* brainfuck implementation */ damn newline!
> 1737234162 809880 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Dan422442 5*  10New user account
> 1737234316 5256 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 10 02https://esolangs.org/w/index.php?diff=150356&oldid=150347 5* 03Aadenboy 5* (+2485) 10add [[File:KawaBrainfuckImplementation.png|brainfuck implementation]]
> 1737234751 989460 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 M10 02https://esolangs.org/w/index.php?diff=150357&oldid=150356 5* 03Aadenboy 5* (+18) 10
< 1737235627 403325 :Ae!Ae@linux.touz.org QUIT :Killed (NickServ (GHOST command used by ae2!thelounge@user/ae))
< 1737235636 473812 :Ae!Ae@linux.touz.org JOIN #esolangs * :Ae
< 1737235640 215974 :Ae!Ae@linux.touz.org NICK :Guest6479
< 1737235745 562871 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737236651 242582 PRIVMSG #esolangs :14[[07Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;14]]4 M10 02https://esolangs.org/w/index.php?diff=150358&oldid=150332 5* 03Aadenboy 5* (+319) 10
> 1737237580 142450 PRIVMSG #esolangs :14[[07Looping counter14]]4 10 02https://esolangs.org/w/index.php?diff=150359&oldid=150248 5* 03Jan jelo 5* (+101) 10/* Thue */
> 1737240476 485320 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150360&oldid=150343 5* 03Blashyrkh 5* (+1232) 10Lazy K example
> 1737240766 88023 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150361&oldid=150360 5* 03Blashyrkh 5* (+60) 10
< 1737241794 842674 :Everything!~Everythin@195.138.86.118 QUIT :Quit: leaving
< 1737242615 474564 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User
< 1737243618 292369 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
> 1737244026 417750 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150362&oldid=150361 5* 03Jan jelo 5* (+97) 10/* Python 3 */
< 1737244970 517034 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737245168 484947 :mtm!~textual@47.202.75.129 JOIN #esolangs * :Textual User
< 1737245182 506885 :slavfox!~slavfox@193.28.84.183 QUIT :Quit: ZNC 1.8.2 - https://znc.in
< 1737245205 326880 :slavfox!~slavfox@193.28.84.183 JOIN #esolangs slavfox :slavfox
> 1737245837 725333 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150363&oldid=150362 5* 03Jan jelo 5* (+473) 10
> 1737246149 547840 PRIVMSG #esolangs :14[[07Thue14]]4 10 02https://esolangs.org/w/index.php?diff=150364&oldid=150320 5* 03Jan jelo 5* (+520) 10/* Sample programs */
> 1737246201 682036 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150365&oldid=150364 5* 03Jan jelo 5* (+0) 10/* Sample programs */
> 1737246716 561286 PRIVMSG #esolangs :14[[07Thue14]]4 M10 02https://esolangs.org/w/index.php?diff=150366&oldid=150365 5* 03Jan jelo 5* (-32) 10/* Sample programs */
< 1737246817 548153 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
> 1737246832 874103 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150367&oldid=150363 5* 03Jan jelo 5* (-31) 10/* Thue */
< 1737249811 571504 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Quit: Client closed
< 1737253262 554967 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
< 1737254215 438659 :ais523!~ais523@user/ais523 JOIN #esolangs ais523 :(this is obviously not my real name)
> 1737255176 393503 PRIVMSG #esolangs :14[[07Translated /PSTF Again414]]4 10 02https://esolangs.org/w/index.php?diff=150368&oldid=150277 5* 03MihaiEso 5* (+50) 10
> 1737255750 557679 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 N10 02https://esolangs.org/w/index.php?oldid=150369 5* 03MihaiEso 5* (+1102) 10Created page with "1. Take that [[Translated /PSTF Again4|]]. 
             
2. Buy a Windows XP computer and install games on it and game for 24/7 straight. Lastly, destroy the computer, add 100000000000000 kilograms of washing machine and chi..." < 1737255903 153589 :op_4!~tslil@user/op-4/x-9116473 QUIT :Remote host closed the connection < 1737255933 111941 :op_4!~tslil@user/op-4/x-9116473 JOIN #esolangs op_4 :op_4 > 1737256230 916744 PRIVMSG #esolangs :14[[07Obfunge14]]4 N10 02https://esolangs.org/w/index.php?oldid=150370 5* 03None1 5* (+3033) 10Created page with "'''Obfunge''' is a [[Befunge]]-93 derivative invented by [[User:None1]], it is Befunge-93 but obfuscated. ==Instructions== Befunge-93 has the following commands: {| class="wikitable" !Cmd !Description |- |! |Addition: Pop two values a and b, then push the r > 1737261176 358626 PRIVMSG #esolangs :14[[07Obfunge14]]4 M10 02https://esolangs.org/w/index.php?diff=150371&oldid=150370 5* 03Calculus is fun 5* (-1) 10Fixed typo of "Decryption" > 1737262580 570466 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150372&oldid=150367 5* 03Calculus is fun 5* (+246) 10Added MoreMathRPN example > 1737262647 270840 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150373&oldid=150273 5* 03Calculus is fun 5* (+55) 10/* Examples elsewhere on this site */ > 1737262971 899934 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150374&oldid=150372 5* 03Calculus is fun 5* (+29) 10/* MoreMathRPN */ > 1737263526 556207 PRIVMSG #esolangs :14[[07User:XKCD Random Number14]]4 10 02https://esolangs.org/w/index.php?diff=150375&oldid=150225 5* 03WinslowJosiah 5* (+302) 10Correction/addition for Bespoke > 1737264278 673423 PRIVMSG #esolangs :14[[07User:Calculus is fun14]]4 M10 02https://esolangs.org/w/index.php?diff=150376&oldid=150271 5* 03Calculus is fun 5* (-20) 10Removed people tag > 1737269956 982156 PRIVMSG #esolangs :14[[07Kawa14]]4 M10 02https://esolangs.org/w/index.php?diff=150377&oldid=150355 5* 03Aadenboy 5* (+27) 10 < 1737270188 67262 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1737270260 819827 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Client Quit > 1737270290 696457 PRIVMSG #esolangs :14[[07User:UrnEn/Sandbox14]]4 M10 02https://esolangs.org/w/index.php?diff=150378&oldid=150340 5* 03UrnEn 5* (+0) 10/* 99 Bottles of Beer in something like Tokipona */ > 1737270617 824937 PRIVMSG #esolangs :14[[07User:Aadenboy14]]4 M10 02https://esolangs.org/w/index.php?diff=150379&oldid=150274 5* 03Aadenboy 5* (-20) 10300! > 1737271328 719531 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150380&oldid=150341 5* 03UrnEn 5* (+151) 10 > 1737272170 882872 PRIVMSG #esolangs :14[[07OISC14]]4 M10 02https://esolangs.org/w/index.php?diff=150381&oldid=148981 5* 03Tomhe 5* (+58) 10/* External resources */ < 1737272759 476643 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Remote host closed the connection < 1737272817 173842 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron < 1737273576 455496 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname < 1737276283 812387 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1737276731 2269 PRIVMSG #esolangs :14[[07Talk:SendStuff14]]4 M10 02https://esolangs.org/w/index.php?diff=150382&oldid=20017 5* 03Calculus is fun 5* (+205) 10Question > 1737277736 808558 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150383&oldid=150374 5* 03PkmnQ 5* (+900) 10/* Binary lambda calculus */ Reformat program, add breakdown < 1737278166 300864 :craigo!~craigo@user/craigo QUIT :Quit: Leaving < 1737278221 118501 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname > 1737279726 972537 PRIVMSG #esolangs :14[[07Special:Log/newusers14]]4 create10 02 5* 03Pantuga 5* 10New user account > 1737280070 513417 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150384&oldid=150383 5* 03Jan jelo 5* (+308) 10/* Examples */ > 1737280353 893789 PRIVMSG #esolangs :14[[07Esolang:Introduce yourself14]]4 10 02https://esolangs.org/w/index.php?diff=150385&oldid=150239 5* 03Pantuga 5* (+163) 10/* Introductions */ > 1737281790 62219 PRIVMSG #esolangs :14[[07User:Jan jelo14]]4 10 02https://esolangs.org/w/index.php?diff=150386&oldid=150223 5* 03Jan jelo 5* (+42) 10/* Intepreters */ > 1737281991 605607 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 10 02https://esolangs.org/w/index.php?diff=150387&oldid=148766 5* 03Jan jelo 5* (+4635) 10/* Standard */ < 1737283450 28041 :APic!apic@apic.name PRIVMSG #esolangs :Hi < 1737285471 166338 :Sgeo!~Sgeo@user/sgeo QUIT :Read error: Connection reset by peer < 1737285599 583492 :ais523!~ais523@user/ais523 QUIT :Quit: quit > 1737286109 221102 PRIVMSG #esolangs :14[[07Esolang:Categorization14]]4 10 02https://esolangs.org/w/index.php?diff=150388&oldid=150195 5* 03Kevidryon2 5* (+27) 10Added tree-based category < 1737288174 453776 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 260 seconds < 1737288336 476271 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User > 1737288427 248020 PRIVMSG #esolangs :14[[07Translated /PSTF Again514]]4 N10 02https://esolangs.org/w/index.php?oldid=150389 5* 03PrySigneToFry 5* (+5179) 10Created page with "[[Translated /Mihai Again2|Warning: Your system is corrupted. It can't be trustfEfD?H?H?uHEfD??z ?L? SUVWH?3=??H??Gx4HH$h1 H?uf?^?f?^??Hf??_^][?L? SVWH..." > 1737288463 613899 PRIVMSG #esolangs :14[[07Translated /PSTF Again514]]4 10 02https://esolangs.org/w/index.php?diff=150390&oldid=150389 5* 03PrySigneToFry 5* (+58) 10 > 1737288620 174121 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 10 02https://esolangs.org/w/index.php?diff=150391&oldid=150369 5* 03PrySigneToFry 5* (+86) 10 > 1737289857 728061 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 10 02https://esolangs.org/w/index.php?diff=150392&oldid=150380 5* 03Piet; 5* (+228) 10Reply > 1737289889 750035 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150393&oldid=150392 5* 03Piet; 5* (+4) 10 > 1737289910 210298 PRIVMSG #esolangs :14[[07User talk:UrnEn14]]4 M10 02https://esolangs.org/w/index.php?diff=150394&oldid=150393 5* 03Piet; 5* (+0) 10 > 1737290019 17691 PRIVMSG #esolangs :14[[07OISC14]]4 10 02https://esolangs.org/w/index.php?diff=150395&oldid=150381 5* 03Piet; 5* (+13) 10 < 1737291974 896871 :__monty__!~toonn@user/toonn JOIN #esolangs toonn :Unknown < 1737292055 87661 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1737295929 922915 PRIVMSG #esolangs :14[[07User:ClearLimediWater14]]4 10 02https://esolangs.org/w/index.php?diff=150396&oldid=150018 5* 03ClearLimediWater 5* (+1393) 10 < 1737297156 865888 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1737298482 982093 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net JOIN #esolangs amby :realname > 1737302220 875514 PRIVMSG #esolangs :14[[07Joke language list14]]4 M10 02https://esolangs.org/w/index.php?diff=150397&oldid=149951 5* 03TheCanon2 5* (+29) 10/* Example-based languages */ < 1737302527 520550 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… < 1737303863 279319 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User > 1737304395 805624 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150398&oldid=144784 5* 03TheCanon2 5* (+42) 10Igblan doesn't appear to exist anymore. > 1737304547 644796 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150399&oldid=150398 5* 03TheCanon2 5* (+2) 10 > 1737304765 908127 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150400&oldid=150399 5* 03TheCanon2 5* (-1) 10used incorrect link > 1737306461 167371 PRIVMSG #esolangs :14[[07Translated /Mihai Again214]]4 10 02https://esolangs.org/w/index.php?diff=150401&oldid=150391 5* 03MihaiEso 5* (+10) 10 > 1737306592 24269 PRIVMSG #esolangs :14[[07Short Minsky Machine Notation14]]4 M10 02https://esolangs.org/w/index.php?diff=150402&oldid=136693 5* 03TheCanon2 5* (+110) 10 < 1737308848 992436 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz… > 1737308993 931734 PRIVMSG #esolangs :14[[07User:TheCanon214]]4 M10 02https://esolangs.org/w/index.php?diff=150403&oldid=150068 5* 03TheCanon2 5* (-4) 10Or++ Turing completeness disproven > 1737309086 209407 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 N10 02https://esolangs.org/w/index.php?oldid=150404 5* 03Calculus is fun 5* (+2810) 10Added MoreMathRPN/brainfuck > 1737309348 93458 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150405&oldid=150373 5* 03Calculus is fun 5* (+153) 10Brainfuck interpreter > 1737309401 232667 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=150406&oldid=150404 5* 03Calculus is fun 5* (+12) 10Changed back location > 1737309610 379225 PRIVMSG #esolangs :14[[07MoreMathRPN/brainfuck interpreter14]]4 M10 02https://esolangs.org/w/index.php?diff=150407&oldid=150406 5* 03Calculus is fun 5* (+111) 10Added footnote > 1737309656 890551 PRIVMSG #esolangs :14[[07Special:Log/move14]]4 move10 02 5* 03Calculus is fun 5* 10moved [[02MoreMathRPN/brainfuck interpreter10]] to [[MoreMathRPN/Brainfuck interpreter]]: Misspelled title > 1737309690 712817 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150410&oldid=150405 5* 03Calculus is fun 5* (+0) 10moved link > 1737309845 860524 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150411&oldid=150387 5* 03Calculus is fun 5* (+61) 10Added MoreMathRPN example < 1737310004 275923 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl JOIN #esolangs * :Textual User < 1737311913 386063 :craigo!~craigo@user/craigo QUIT :Quit: Leaving < 1737312114 17594 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 QUIT :Ping timeout: 248 seconds < 1737312372 83763 :Lord_of_Life!~Lord@user/lord-of-life/x-2819915 JOIN #esolangs Lord_of_Life :Lord > 1737314545 552413 PRIVMSG #esolangs :14[[07Short Minsky Machine Notation14]]4 10 02https://esolangs.org/w/index.php?diff=150412&oldid=150402 5* 0347 5* (-10) 10"
" technicaly just shows text unformated
< 1737314604 246273 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl QUIT :
> 1737315411 571411 PRIVMSG #esolangs :14[[07EsoInterpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150413&oldid=150400 5* 03Aadenboy 5* (+523) 10/* Main table */ adding [[kawa]]
> 1737316167 560839 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=150414&oldid=149336 5* 0347 5* (+2) 10
> 1737316198 741927 PRIVMSG #esolangs :14[[07Ti!14]]4 10 02https://esolangs.org/w/index.php?diff=150415&oldid=150414 5* 0347 5* (+31) 10
< 1737317016 715270 :APic!apic@apic.name PRIVMSG #esolangs :cu
< 1737318631 920247 :Sgeo!~Sgeo@user/sgeo JOIN #esolangs Sgeo :realname
< 1737319638 356823 :FreeFull!~freefull@etk172.neoplus.adsl.tpnet.pl JOIN #esolangs FreeFull :FreeFull
< 1737322500 226251 :Everything!~Everythin@195.138.86.118 JOIN #esolangs Everything :Everything
< 1737325629 803855 :Taneb!~Taneb@runciman.hacksoc.org JOIN #esolangs Taneb :Nathan van Doorn
> 1737326973 535094 PRIVMSG #esolangs :14[[07Brainfuck/Esointerpreters14]]4 M10 02https://esolangs.org/w/index.php?diff=150416&oldid=150411 5* 03Aadenboy 5* (+125) 10/* Standard */ add [[Kawa]]
< 1737328435 169955 :vyv!~vyv@76.65.7.60 JOIN #esolangs vyv :vyv verver
< 1737328529 820606 :Everything!~Everythin@195.138.86.118 QUIT :Quit: Lost terminal
< 1737329424 907485 :tromp!~textual@92-110-219-57.cable.dynamic.v4.ziggo.nl QUIT :Quit: My iMac has gone to sleep. ZZZzzz…
< 1737329853 417359 :vyv!~vyv@76.65.7.60 QUIT :Quit: Konversation terminated!
< 1737330181 136101 :__monty__!~toonn@user/toonn QUIT :Quit: leaving
< 1737331430 572391 :mtm!~textual@47.202.75.129 QUIT :Ping timeout: 252 seconds
< 1737331584 633055 :mtm!~textual@47.202.75.129 JOIN #esolangs mtm :Textual User
> 1737333740 305876 PRIVMSG #esolangs :14[[07MoreMathRPN/Quine14]]4 N10 02https://esolangs.org/w/index.php?oldid=150417 5* 03Calculus is fun 5* (+2902) 10Added MoreMathRPN quines
> 1737334025 212016 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150418&oldid=150410 5* 03Calculus is fun 5* (+136) 10Quines
> 1737336467 140266 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150419&oldid=150418 5* 03Aadenboy 5* (-17) 10
< 1737336817 331016 :fowl!~fowl@user/fowl QUIT :Ping timeout: 244 seconds
< 1737338190 672334 :amby!~ambylastn@ward-15-b2-v4wan-167229-cust809.vm18.cable.virginm.net QUIT :Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement
> 1737339079 182146 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150420&oldid=150419 5* 03Calculus is fun 5* (+188) 10added infobox
> 1737339102 472810 PRIVMSG #esolangs :14[[07MoreMathRPN14]]4 M10 02https://esolangs.org/w/index.php?diff=150421&oldid=150420 5* 03Calculus is fun 5* (-4) 10
> 1737340614 583641 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150422&oldid=150384 5* 03Jan jelo 5* (+537) 10/* brainfuck */
< 1737341097 185632 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Read error: Connection reset by peer
< 1737341122 391817 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs yewscion :Claire Rodriguez
> 1737341177 570134 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150423&oldid=150422 5* 03Jan jelo 5* (+4) 10/* Muriel */
< 1737341225 50771 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 QUIT :Excess Flood
< 1737341243 798416 :yewscion!~yewscion@2601:547:1400:1ab0:3de7:b1f7:6b12:760 JOIN #esolangs * :Claire Rodriguez
< 1737341319 675486 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 JOIN #esolangs * :[https://web.libera.chat] impomatic
> 1737343046 257441 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150424&oldid=150423 5* 03Jan jelo 5* (-21) 10/* brainfuck */
< 1737343721 68216 :impomatic!~impomatic@2a00:23c7:5fc9:5401:e55d:205e:c7f9:24d2 QUIT :Quit: Client closed
> 1737343797 572938 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150425&oldid=150424 5* 03Jan jelo 5* (+19) 10/* brainfuck */
> 1737344887 405941 PRIVMSG #esolangs :14[[07Special:Log/upload14]]4 upload10 02 5* 03Aadenboy 5*  10uploaded "[[02File:KawaKolakoskiSequence.png10]]": [[Kolakoski sequence]] in [[Kawa]]
> 1737344911 688802 PRIVMSG #esolangs :14[[07Kawa14]]4 10 02https://esolangs.org/w/index.php?diff=150427&oldid=150377 5* 03Aadenboy 5* (+67) 10/* Example Programs */ add [[Kolakoski sequence]]
> 1737344968 94302 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150428&oldid=150425 5* 03Aadenboy 5* (+114) 10/* Examples */ add [[Kawa]]
> 1737344980 914172 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 M10 02https://esolangs.org/w/index.php?diff=150429&oldid=150428 5* 03Aadenboy 5* (+1) 10/* Kawa */ not again
> 1737345015 433329 PRIVMSG #esolangs :14[[07Kawa/Raw programs14]]4 M10 02https://esolangs.org/w/index.php?diff=150430&oldid=150357 5* 03Aadenboy 5* (+361) 10add [[Kolakoski sequence]]
> 1737347309 459170 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150431&oldid=150429 5* 03Jan jelo 5* (+17) 10/* Lazy K */
> 1737349806 852928 PRIVMSG #esolangs :14[[07Tiny14]]4 10 02https://esolangs.org/w/index.php?diff=150432&oldid=149685 5* 03Ron.hudson 5* (-108) 10
> 1737349932 304743 PRIVMSG #esolangs :14[[07Tiny14]]4 10 02https://esolangs.org/w/index.php?diff=150433&oldid=150432 5* 03Ron.hudson 5* (-73) 10
> 1737350156 495368 PRIVMSG #esolangs :14[[07Kolakoski sequence14]]4 10 02https://esolangs.org/w/index.php?diff=150434&oldid=150431 5* 03Jan jelo 5* (+67) 10
< 1737350911 273190 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Excess Flood
< 1737351003 349471 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737351637 203228 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Ping timeout: 248 seconds
< 1737352012 989263 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737352254 647419 :Noisytoot!~noisytoot@user/meow/Noisytoot QUIT :Excess Flood
< 1737352430 319565 :Noisytoot!~noisytoot@user/meow/Noisytoot JOIN #esolangs Noisytoot :Ron
< 1737353219 110542 :craigo!~craigo@user/craigo JOIN #esolangs craigo :realname