00:00:08 <b_jonas> HNY UK, Ireland, Portugal, Iceland
00:00:10 <esolangs> [[2025!]] N https://esolangs.org/w/index.php?oldid=149135 * Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff * (+497) Created page with "'''2025!''' is an esolang made by [[User:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]]. It only has one command, <code>''number</code>, which time travels to January 1st of the year ''numbe
00:00:39 <esolangs> [[User:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]] https://esolangs.org/w/index.php?diff=149136&oldid=148958 * Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff * (+36)
00:03:38 -!- mtm has quit (Ping timeout: 244 seconds).
00:05:13 -!- mtm has joined.
00:25:17 <fizzie> Was going to watch the London fireworks from the office terrace this year, but due to high winds they kept it closed.
00:25:38 <fizzie> So watched it through a very reflective glass instead.
00:30:23 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
00:39:09 <Sgeo> I wonder if anyone's written games for a hypothetical I/O extended Fractran. Thinking about it because I think (but not sure) that Fractran might be easy to implement in WorldsPlayer
00:48:24 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149137&oldid=149111 * Waffelz * (+79)
01:20:31 -!- bongino has quit (Ping timeout: 265 seconds).
01:42:11 <esolangs> [[Talk:Deadfish]] https://esolangs.org/w/index.php?diff=149138&oldid=147386 * Bogdan192848 * (+2555)
01:43:49 <esolangs> [[Talk:Deadfish]] M https://esolangs.org/w/index.php?diff=149139&oldid=149138 * Bogdan192848 * (+13)
01:47:16 -!- bongino has joined.
01:51:40 <esolangs> [[Talk:Deadfish]] M https://esolangs.org/w/index.php?diff=149140&oldid=149139 * Bogdan192848 * (+182)
02:02:27 <esolangs> [[Talk:Deadfish]] M https://esolangs.org/w/index.php?diff=149141&oldid=149140 * Bogdan192848 * (+80)
02:14:35 -!- __monty__ has quit (Quit: leaving).
02:55:48 <esolangs> [[User:Jan jelo/TC proof to partial recursive function]] https://esolangs.org/w/index.php?diff=149142&oldid=148414 * Jan jelo * (-8) /* proof */
03:03:02 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:30:00 <esolangs> [[User:Jan jelo/TC proof to partial recursive function]] https://esolangs.org/w/index.php?diff=149143&oldid=149142 * Jan jelo * (+76) /* proof */
03:32:49 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=149144&oldid=149067 * PrySigneToFry * (+175) /* */ new section
03:33:12 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=149145&oldid=149144 * PrySigneToFry * (+835) /* */
03:34:10 -!- bongino has changed nick to bongino_.
03:34:38 -!- bongino_ has changed nick to bongino.
03:35:45 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149146&oldid=146882 * PrySigneToFry * (-32)
03:36:44 -!- bongino_ has joined.
03:38:02 <esolangs> [[2024]] https://esolangs.org/w/index.php?diff=149147&oldid=126789 * PrySigneToFry * (-190)
04:18:04 -!- bongino has quit (Quit: Lost terminal).
04:18:08 -!- bongino_ has quit (Remote host closed the connection).
05:00:06 <b_jonas> Happy New Year US east coast!
05:19:00 <wryl> Happy new year!
06:19:57 <b_jonas> another piece of impressive hardware reverse engineering that confirms earlier results of black-box reverse engineering, by Ken Shirriff on the Pentium FDIV bug => https://www.righto.com/2024/12/this-die-photo-of-pentium-shows.html
07:18:56 <korvo> Fascinating read, thanks.
07:20:29 -!- ais523 has joined.
09:44:38 -!- tromp has joined.
09:45:52 <esolangs> [[2024]] https://esolangs.org/w/index.php?diff=149148&oldid=149147 * Ractangle * (+190) LIAR
09:46:59 <esolangs> [[Underload]] https://esolangs.org/w/index.php?diff=149149&oldid=149132 * Ractangle * (-78) /* See also */
09:47:21 <esolangs> [[Underload]] https://esolangs.org/w/index.php?diff=149150&oldid=149149 * Ractangle * (+64) /* External resources */
09:53:20 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149151&oldid=149146 * Ractangle * (+15) /* Implementations */
10:17:02 -!- __monty__ has joined.
10:35:58 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:44:59 <esolangs> [[Alan's dead fish]] M https://esolangs.org/w/index.php?diff=149152&oldid=144080 * Bogdan192848 * (+1)
10:47:36 -!- Sgeo has quit (Read error: Connection reset by peer).
11:01:09 -!- tromp has joined.
11:08:14 <esolangs> [[6 bytes of useless element]] https://esolangs.org/w/index.php?diff=149153&oldid=147682 * 47 * (+60)
11:20:02 -!- __monty__ has quit (Quit: leaving).
11:22:26 -!- __monty__ has joined.
11:33:36 <esolangs> [[Not]] https://esolangs.org/w/index.php?diff=149154&oldid=145295 * 47 * (+3) /* the whole thing */
11:36:10 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149155&oldid=117621 * Kaveh Yousefi * (+440) Rectified two examples and supplemented a page category tag.
11:37:17 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149156&oldid=149155 * Kaveh Yousefi * (+187) Added a hyperlink to my implementation of the Do-if programming language on GitHub and supplemented the Implemented category tag.
11:37:19 <esolangs> [[Not]] https://esolangs.org/w/index.php?diff=149157&oldid=149154 * 47 * (+286) /* Implementation */
11:39:28 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149158&oldid=149156 * Kaveh Yousefi * (+389) Supplemented a looping counter example program.
11:42:18 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149159&oldid=149158 * Kaveh Yousefi * (+1420) Supplemented a Syntax section comprehending an Extended Backus-Naur Form (EBNF) description of the language.
11:45:47 <esolangs> [[Special:Log/newusers]] create * 2Paule * New user account
11:46:45 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149160&oldid=149137 * 2Paule * (+7) /* Introductions */
11:48:22 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149161&oldid=149160 * 2Paule * (+93) /* Introductions */
11:50:53 <esolangs> [[Deadfish/Implementations (M-Z)]] https://esolangs.org/w/index.php?diff=149162&oldid=146286 * 2Paule * (+824)
11:51:16 <esolangs> [[Deadfish/Implementations (M-Z)]] https://esolangs.org/w/index.php?diff=149163&oldid=149162 * 2Paule * (-2) /* [Odin] */
11:53:21 <esolangs> [[Deadfish/Implementations (M-Z)]] https://esolangs.org/w/index.php?diff=149164&oldid=149163 * 2Paule * (+4) /* Odin */
11:54:16 <esolangs> [[Deadfish/Implementations (M-Z)]] https://esolangs.org/w/index.php?diff=149165&oldid=149164 * 2Paule * (+10) /* Odin */
11:57:54 <esolangs> [[HQ9~]] https://esolangs.org/w/index.php?diff=149166&oldid=132957 * LuminanceMartlet * (-1)
12:02:52 -!- mtm has quit (Ping timeout: 265 seconds).
12:06:37 -!- mtm has joined.
13:41:09 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:54:52 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149167&oldid=149159 * Kaveh Yousefi * (+1811) Introduced a section furnishing a treatise on the instructions.
13:55:44 <esolangs> [[Do-if]] https://esolangs.org/w/index.php?diff=149168&oldid=149167 * Kaveh Yousefi * (+203) Accommodated a truth-machine example.
14:26:28 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149169&oldid=128522 * Jan jelo * (+170) /* Examples */
14:31:57 <b_jonas> fizzie: well, now you can test if the state television of Hungary archives are geoip-limited by trying to download the Wiener Philharmoniker Neujahrskonzert within about a week while it stays up. radio version at "https://hangtar-cdn.connectmedia.hu/20250101111459/20250101135724/mr3.mp3" , television version at
14:32:02 <b_jonas> "https://c401-node62-cdn.connectmedia.hu/4511/055d554bf7c713028b764c6db84ffd93/67754ce6/2025/01/01/2025-000007-M0001-01/media_w206153334_b3000000_0.ts" but keep incrementing the number after the last underscore in %d format up to something like 1200 (I haven't downloaded all of it yet)
14:32:21 <b_jonas> get them while they're hot, they usually disappear from the internet quickly
14:45:38 -!- amby has joined.
15:08:00 -!- Everything has joined.
15:17:06 -!- tromp has joined.
15:17:20 -!- tromp has quit (Client Quit).
15:17:59 -!- tromp has joined.
15:43:26 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149170&oldid=149169 * Jan jelo * (+170) /* Examples */
15:45:58 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149171&oldid=149170 * Jan jelo * (+2) /* Fibonacci */
15:59:15 <esolangs> [[User:TheCanon2]] M https://esolangs.org/w/index.php?diff=149172&oldid=148946 * TheCanon2 * (+78) updated
16:15:52 -!- craigo has joined.
16:24:40 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149173&oldid=149171 * Jan jelo * (+203) /* Examples */
16:26:26 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149174&oldid=149173 * Jan jelo * (+17) /* Examples */
16:27:06 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149175&oldid=149174 * Jan jelo * (+17) /* Examples */
16:38:15 <esolangs> [[Muriel]] M https://esolangs.org/w/index.php?diff=149176&oldid=149175 * PkmnQ * (+9) /* Fibonacci */
17:07:42 -!- Everything has quit (Ping timeout: 246 seconds).
17:36:42 <esolangs> [[Talk:Deadfish]] M https://esolangs.org/w/index.php?diff=149177&oldid=149141 * Bogdan192848 * (-2052)
17:52:25 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149178&oldid=149176 * Jan jelo * (+355) /* Examples */
18:06:46 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149179&oldid=148194 * Jan jelo * (+154)
18:07:52 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149180&oldid=149179 * Jan jelo * (+14) /* Intepreters */
18:28:54 -!- Lord_of_Life_ has joined.
18:29:18 -!- Lord_of_Life has quit (Ping timeout: 244 seconds).
18:30:19 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:40:21 <esolangs> [[User:Shamrocky]] https://esolangs.org/w/index.php?diff=149181&oldid=127080 * Shamrocky * (+102) /* SOULSBORNE games */
18:42:10 <esolangs> [[User:Shamrocky]] M https://esolangs.org/w/index.php?diff=149182&oldid=149181 * Shamrocky * (+45) /* World of Goo */
19:03:02 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149183&oldid=149161 * Dmiz * (+229)
19:03:45 <esolangs> [[User:Dmiz]] N https://esolangs.org/w/index.php?oldid=149184 * Dmiz * (+569) Created page with "Numeric is a an esolang based in Ascii and lisp syntax in Snap! {| class="wikitable" |+ Important Commands are: |- ! Ascii !! Equivalent |- | 40 || ( |- | 41 || ) |- | 34 || " |- | 95 || _ |} === Hello World: === 40 40 115 97 121 32 34 72 101 108 108 111 32 87 111 1
19:04:02 <esolangs> [[User:Dmiz]] https://esolangs.org/w/index.php?diff=149185&oldid=149184 * Dmiz * (-410)
19:12:37 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:23:51 <esolangs> [[User:Dmiz]] https://esolangs.org/w/index.php?diff=149186&oldid=149185 * Dmiz * (+612)
19:30:06 <esolangs> [[User:Dmiz]] https://esolangs.org/w/index.php?diff=149187&oldid=149186 * Dmiz * (-454)
19:33:08 -!- tromp has joined.
19:35:26 -!- roper has joined.
19:41:59 <esolangs> [[Numeric]] N https://esolangs.org/w/index.php?oldid=149188 * Dmiz * (+712) Created page with "Numeric is a an esolang based in Ascii and lisp syntax in Snap! {| class="wikitable" |+ Important Commands |- ! Ascii !! Equivalent |- | 32 || space |- | 34 || " |- | 40 || ( |- | 41 || ) |- | 95 || _ |} === Hello World!: === 40 40 115 97 121 32 34 72 101 108 108 111 3
20:16:26 -!- Sgeo has joined.
20:36:38 -!- Festive has changed nick to gAy_Dragon.
20:42:31 -!- Everything has joined.
21:00:39 -!- roper has quit (Quit: [22:00]).
21:09:57 -!- Everything has quit (Quit: leaving).
21:12:37 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149189&oldid=149188 * Dmiz * (+29)
21:13:03 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149190&oldid=149189 * Dmiz * (+0)
21:15:55 -!- craigo_ has joined.
21:17:10 -!- Everything has joined.
21:18:18 -!- craigo has quit (Ping timeout: 246 seconds).
21:25:34 <esolangs> [[Do-if]] M https://esolangs.org/w/index.php?diff=149191&oldid=149168 * Kaveh Yousefi * (+0) Amended an orthographic mistake.
21:50:08 -!- craigo_ has quit (Quit: Leaving).
22:03:03 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149192&oldid=149190 * Dmiz * (+1076)
22:10:11 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149193&oldid=149192 * Dmiz * (-458)
22:11:14 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149194&oldid=149193 * Dmiz * (+10)
22:23:41 <esolangs> [[Fuckbrian]] N https://esolangs.org/w/index.php?oldid=149195 * Tommyaweosme * (+116) Created page with "[[Fuckbrian]] is [[brianfuck]] but only the extra commands == turing completeness == 0 [[categories:joke languages]]"
22:30:46 <esolangs> [[Fuckbrian]] https://esolangs.org/w/index.php?diff=149196&oldid=149195 * Tommyaweosme * (-2)
22:54:26 -!- __monty__ has quit (Quit: leaving).
23:26:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:33:50 -!- Everything has quit (Quit: leaving).
23:44:54 <esolangs> [[SLet/Implementation]] https://esolangs.org/w/index.php?diff=149197&oldid=147152 * ZCX islptng * (-10801) Replaced content with "{{back|SLet}} NOT YET!"
23:45:23 <esolangs> [[SLet/algo]] https://esolangs.org/w/index.php?diff=149198&oldid=146920 * ZCX islptng * (-2397) Blanked the page
23:50:43 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149199&oldid=147212 * ZCX islptng * (-2619)
00:01:18 <esolangs> [[S*bleq]] https://esolangs.org/w/index.php?diff=149200&oldid=141369 * ZCX islptng * (+148)
00:03:35 -!- mtm has quit (Ping timeout: 244 seconds).
00:05:36 -!- mtm has joined.
01:22:17 -!- fria has joined.
01:22:45 -!- fria has quit (Client Quit).
01:30:45 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149201&oldid=149199 * ZCX islptng * (+0)
01:31:49 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149202&oldid=149201 * ZCX islptng * (-1)
02:10:27 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:47:56 <korvo> Ugh, Metamath is such a simple language that it's not worthwhile to write an abstract reusable parser; it takes only like 10-20 lines of Python to parse, starting with .split(), for concrete tasks.
02:48:22 <korvo> This isn't bad, but I'm into Yet Another 40-Line Script instead of building abstractions, which feels like an unsustainable direction.
03:05:38 -!- ais523 has quit (Quit: quit).
03:13:14 <esolangs> [[Special:Log/newusers]] create * Hajunsheng * New user account
04:22:04 -!- Sgeo has quit (Ping timeout: 260 seconds).
04:22:49 -!- Sgeo has joined.
05:31:25 <esolangs> [[Closuretalk]] M https://esolangs.org/w/index.php?diff=149203&oldid=148999 * Rdococ * (-413) /* Conclusion */
07:24:20 -!- Sgeo has quit (Read error: Connection reset by peer).
08:23:42 -!- tromp has joined.
09:42:17 <esolangs> [[Sep]] N https://esolangs.org/w/index.php?oldid=149204 * ZCX islptng * (+303) Created page with "Sep is an esolang created by islptng. ==Commands== <nowiki><pre> >a a = input <a print(a) 'x print a character \x print the escaped character # break from loop {[v1]c1[v2]c2 ... [vn]cn[vd]} for i = v1 to vd, if v1 <= i < v2, execute c1. if v2 <= i < v3,
09:42:32 <esolangs> [[Sep]] https://esolangs.org/w/index.php?diff=149205&oldid=149204 * ZCX islptng * (+0) fix
09:44:22 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:44:32 <esolangs> [[Sep]] https://esolangs.org/w/index.php?diff=149206&oldid=149205 * ZCX islptng * (+57)
09:54:19 <esolangs> [[Sep]] https://esolangs.org/w/index.php?diff=149207&oldid=149206 * ZCX islptng * (+257)
09:55:10 <esolangs> [[Sep]] https://esolangs.org/w/index.php?diff=149208&oldid=149207 * ZCX islptng * (+88)
10:05:25 -!- roper has joined.
10:15:48 -!- __monty__ has joined.
10:54:14 -!- zenmov has joined.
11:09:36 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=149209&oldid=149145 * None1 * (+325) /* */
11:20:18 -!- Lymia has quit (Ping timeout: 276 seconds).
11:20:56 -!- Lymia has joined.
11:29:05 <shachaf> This number format seems appropriate for this channe: https://adamscherlis.github.io/blog/iterlog-coding/
11:29:22 -!- tromp has joined.
11:57:52 <int-e> a floating point Levenshtein-like coding?
12:03:56 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:44 -!- mtm has joined.
12:09:07 -!- roper has quit (Read error: Connection reset by peer).
12:14:26 -!- roper has joined.
12:26:23 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149210&oldid=149178 * Jan jelo * (+182) /* Examples */
12:34:41 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149211&oldid=149210 * Jan jelo * (+185) /* Examples */
12:48:51 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149212&oldid=149211 * Jan jelo * (+11) /* Examples */
12:51:32 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=149213&oldid=146880 * Jan jelo * (+191) /* Examples */
13:05:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:12:39 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=149214&oldid=149213 * 47 * (+70) /* Python */
13:15:53 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=149215&oldid=149214 * 47 * (-1) /* Python */
13:25:59 -!- chiselfuse has quit (Remote host closed the connection).
13:26:14 -!- chiselfuse has joined.
13:31:43 -!- roper has quit (Quit: volta).
13:48:02 <b_jonas> `learn password The password of the month is not from a jedi.
13:48:09 <HackEso> Relearned 'password': password The password of the month is not from a jedi.
13:52:21 <b_jonas> shachaf: yes that does seem appropriate here
13:54:33 <esolangs> [[Special:Log/newusers]] create * Calculus is fun * New user account
14:02:46 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149216&oldid=149183 * Calculus is fun * (+186)
14:03:25 <esolangs> [[Special:Log/move]] move * 47 * moved [[Pycone]] to [[Track!]]
14:03:26 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149219&oldid=149216 * Calculus is fun * (+106)
14:04:13 <esolangs> [[Track!]] https://esolangs.org/w/index.php?diff=149220&oldid=149217 * 47 * (-237)
14:10:21 -!- zenmov has quit (Ping timeout: 252 seconds).
14:11:40 -!- tromp has joined.
14:12:09 -!- zenmov has joined.
14:44:01 -!- ais523 has joined.
15:00:19 -!- Sgeo has joined.
15:17:16 <esolangs> [[Special:Log/upload]] upload * Calculus is fun * uploaded "[[File:MoreMathLogo.png]]"
15:20:33 -!- roper has joined.
15:38:24 -!- tromp has quit (Read error: Connection reset by peer).
15:41:06 -!- ais523 has quit (Quit: quit).
16:23:54 -!- tromp has joined.
16:58:08 <esolangs> [[MoreMathRPN]] N https://esolangs.org/w/index.php?oldid=149222 * Calculus is fun * (+3180) Intro, Logo, partially done with commands.
17:11:51 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149223&oldid=149222 * Calculus is fun * (+482) Added Category tags at bottom
17:24:07 -!- roper has quit (Read error: Connection reset by peer).
17:29:33 -!- roper has joined.
17:51:13 -!- ^[ has quit (Ping timeout: 245 seconds).
17:53:06 -!- ^[ has joined.
18:20:46 <esolangs> [[InfuckBra]] N https://esolangs.org/w/index.php?oldid=149224 * Tommyaweosme * (+484) Created page with "{{lowercase}}infuckBra is [[brainfuck]] but its on a torus, so at the end, the code will go back to the start again with the same cell confirgurations == extra commands == % - skip next command if this is not first time through == conceptualizing == the script "+
18:29:23 -!- Lord_of_Life_ has joined.
18:29:25 -!- zenmov has quit (Ping timeout: 252 seconds).
18:30:43 -!- Lord_of_Life has quit (Ping timeout: 264 seconds).
18:30:44 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:34:35 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:40:30 <esolangs> [[Muriel/compile from minsky machine]] N https://esolangs.org/w/index.php?oldid=149225 * Jan jelo * (+1610) Created page with "This python program compiles minsky machine program into Muriel program.(Using state 0 means halt, and the program starts from state 1.) <pre> program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' def r(s): return (s.replace("\\","\\\
18:45:11 <esolangs> [[Muriel/compile from minsky machine]] https://esolangs.org/w/index.php?diff=149226&oldid=149225 * Jan jelo * (+1137)
18:46:14 <esolangs> [[Muriel/compile from minsky machine]] M https://esolangs.org/w/index.php?diff=149227&oldid=149226 * Jan jelo * (+0)
18:51:03 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149228&oldid=149212 * Jan jelo * (+140) /* Computational class */
18:51:29 <esolangs> [[Muriel/compile from minsky machine]] M https://esolangs.org/w/index.php?diff=149229&oldid=149227 * Jan jelo * (+0)
18:56:43 <esolangs> [[Deadman]] N https://esolangs.org/w/index.php?oldid=149230 * Win7HE * (+1128) Created page with "'''Deadman''' is created by [[Win7HE]], that contains new stuff like , , , and input, and is a joke language. == Commands == is i, is d, is s, is o, multiplies by 2, changes the code pointer position to the accumulator, sets the accumulator to nothing, sets the
18:57:09 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149231&oldid=149230 * Win7HE * (+5)
18:57:32 <esolangs> [[Muriel/compile from minsky machine]] https://esolangs.org/w/index.php?diff=149232&oldid=149229 * Jan jelo * (+21)
18:58:29 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149233&oldid=149231 * Win7HE * (+9)
18:58:52 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149234&oldid=149233 * Win7HE * (+2) /* Hello world program */
18:59:23 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149235&oldid=149234 * Win7HE * (+13) /* (without looping with jumps) Truth Machine */
19:00:21 <esolangs> [[Deadfish]] https://esolangs.org/w/index.php?diff=149236&oldid=148298 * Win7HE * (+121)
19:00:33 <esolangs> [[Talk:Muriel]] https://esolangs.org/w/index.php?diff=149237&oldid=116445 * Jan jelo * (+232)
19:01:13 <esolangs> [[Deadfish]] https://esolangs.org/w/index.php?diff=149238&oldid=149236 * Win7HE * (+51) /* Variants of deadfish */
19:07:28 -!- tromp has joined.
19:25:55 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149239&oldid=149223 * Calculus is fun * (+1373) Finished command list
19:34:06 -!- roper has quit (Read error: Connection reset by peer).
19:35:55 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:39:31 -!- roper has joined.
19:41:01 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149240&oldid=149239 * Calculus is fun * (+362) /* Creating conditions */
19:45:40 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149241&oldid=149240 * Calculus is fun * (+22) /* Creating conditions */
19:46:50 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149242&oldid=149241 * Calculus is fun * (+56) /* Standard operations */
19:52:44 -!- tromp has joined.
20:02:05 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149243&oldid=149242 * Calculus is fun * (+512) Added examples
20:02:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:04:44 -!- craigo has joined.
20:46:39 <esolangs> [[Talk:///]] https://esolangs.org/w/index.php?diff=149244&oldid=78537 * Jan jelo * (+200) /* Programming quirk? */
20:55:43 -!- roper has quit (Quit: zzz).
21:28:20 -!- tromp has joined.
21:36:09 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149245&oldid=149243 * 47 * (-20) /* Implementations */
21:37:38 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149246&oldid=149245 * 47 * (-239) /* Implementations */
21:39:08 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149247&oldid=149246 * 47 * (-33) /* Implementations */
21:39:33 <esolangs> [[Brain]] https://esolangs.org/w/index.php?diff=149248&oldid=127206 * 47 * (-19) /* Categories */
21:40:02 <esolangs> [[F'juhv iK'tlhUng]] https://esolangs.org/w/index.php?diff=149249&oldid=141956 * 47 * (-19) /* Categories */
21:40:31 <esolangs> [[Scrambled]] https://esolangs.org/w/index.php?diff=149250&oldid=127137 * 47 * (-19) /* Categories */
21:40:50 <esolangs> [[TlhIngan]] https://esolangs.org/w/index.php?diff=149251&oldid=124792 * 47 * (-19) /* Valid identifier */
21:40:51 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149252&oldid=133750 * .k * (+117)
21:41:03 <esolangs> [[TREE(3)]] https://esolangs.org/w/index.php?diff=149253&oldid=126294 * 47 * (-19) /* Categories */
21:41:49 <esolangs> [[Esme]] https://esolangs.org/w/index.php?diff=149254&oldid=94111 * 47 * (-22) /* Implementations */
21:42:02 <esolangs> [[FURscript]] https://esolangs.org/w/index.php?diff=149255&oldid=99217 * 47 * (-22) /* Compilers */
21:42:19 <esolangs> [[Snack]] https://esolangs.org/w/index.php?diff=149256&oldid=102375 * 47 * (-22) /* Another simple interpreter */
21:44:38 <esolangs> [[BittyLang]] https://esolangs.org/w/index.php?diff=149257&oldid=143746 * 47 * (-1) /* Interpreter in Python */
22:38:48 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149258&oldid=149252 * .k * (+41)
22:39:57 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149259&oldid=149258 * .k * (-41) Undo revision [[Special:Diff/149258|149258]] by [[Special:Contributions/.k|.k]] ([[User talk:.k|talk]])
22:46:34 -!- amby has joined.
22:47:20 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:50:06 -!- tromp has joined.
22:58:33 <esolangs> [[Kiwiscript]] https://esolangs.org/w/index.php?diff=149260&oldid=135542 * Dmiz * (+146)
22:59:08 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149261&oldid=149194 * Dmiz * (+147)
22:59:09 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:02:36 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149262&oldid=149114 * Dmiz * (+14) numeric
23:11:54 <esolangs> [[Category:2025]] https://esolangs.org/w/index.php?diff=149263&oldid=129117 * Dmiz * (+13)
23:12:40 <esolangs> [[Category:2025]] https://esolangs.org/w/index.php?diff=149264&oldid=149263 * Dmiz * (-13)
23:14:14 -!- tromp has joined.
23:15:21 <esolangs> [[Category:2025]] https://esolangs.org/w/index.php?diff=149265&oldid=149264 * Dmiz * (+31)
23:15:54 <esolangs> [[Category:2025]] https://esolangs.org/w/index.php?diff=149266&oldid=149265 * Dmiz * (+23)
23:16:03 <esolangs> [[Category:2025]] https://esolangs.org/w/index.php?diff=149267&oldid=149266 * Dmiz * (-54)
23:17:45 -!- chiselfuse has quit (Remote host closed the connection).
23:17:48 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149268&oldid=149261 * Dmiz * (+14)
23:18:00 -!- chiselfuse has joined.
23:18:04 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149269&oldid=149268 * Dmiz * (-14)
23:18:31 <esolangs> [[Talk:Numeric]] N https://esolangs.org/w/index.php?oldid=149270 * Dmiz * (+17) Created page with "[[Category:2025]]"
23:19:00 <esolangs> [[Talk:Numeric]] https://esolangs.org/w/index.php?diff=149271&oldid=149270 * Dmiz * (-17) Blanked the page
23:19:24 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149272&oldid=149269 * Dmiz * (+15)
23:19:44 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=149273&oldid=149272 * Dmiz * (+4)
23:20:40 -!- __monty__ has quit (Quit: leaving).
23:30:22 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
00:02:34 -!- mtm has quit (Ping timeout: 260 seconds).
00:05:35 -!- mtm has joined.
00:10:12 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149274&oldid=145213 * Kloodi * (-2) /* Truth Machine */
00:24:28 -!- fowl has joined.
00:44:27 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149275&oldid=149262 * Calculus is fun * (+18) Added MoreMathRPN
00:57:27 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149276&oldid=149247 * Calculus is fun * (+335) Added matrix example
01:34:37 -!- amby has quit (Ping timeout: 252 seconds).
01:39:12 -!- amby has joined.
01:54:20 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149277&oldid=149276 * Calculus is fun * (+648) Fractran example
02:00:08 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:04:00 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149278&oldid=149277 * Calculus is fun * (+0) /* Fibonnaci */
02:04:57 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149279&oldid=149278 * Calculus is fun * (+0) /* Fractran interpreter */
02:18:46 -!- FreeFull has quit.
02:40:30 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149280&oldid=149279 * Calculus is fun * (+7) replaced ascii arrows with unicode arrows
04:04:13 <esolangs> [[Sep]] https://esolangs.org/w/index.php?diff=149281&oldid=149208 * ZCX islptng * (+2)
08:15:59 -!- Sgeo has quit (Read error: Connection reset by peer).
08:28:09 -!- tromp has joined.
08:34:20 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149282&oldid=149235 * Win7HE * (+95)
08:38:53 <esolangs> [[Kiwiscript]] https://esolangs.org/w/index.php?diff=149283&oldid=149260 * Ractangle * (-1)
08:40:10 <esolangs> [[User:Win7HE]] https://esolangs.org/w/index.php?diff=149284&oldid=148721 * Win7HE * (+210)
08:44:28 <esolangs> [[Talk:Deadman]] N https://esolangs.org/w/index.php?oldid=149285 * Win7HE * (+20) Created page with "hi - [[User:Win7HE]]"
08:45:11 <esolangs> [[User:Win7HE]] https://esolangs.org/w/index.php?diff=149286&oldid=149284 * Win7HE * (+31) /* Deadman (technically deadfish 2.1) */
08:45:59 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149287&oldid=149282 * Win7HE * (+36)
08:46:56 <esolangs> [[Talk:Deadfish/Constants]] N https://esolangs.org/w/index.php?oldid=149288 * Win7HE * (+23) Created page with "hello - [[User:Win7HE]]"
08:53:18 <esolangs> [[Talk:Deadfish with gotos and input]] https://esolangs.org/w/index.php?diff=149289&oldid=148254 * Win7HE * (-98)
08:53:39 <esolangs> [[Talk:Deadfish with gotos and input]] https://esolangs.org/w/index.php?diff=149290&oldid=149289 * Win7HE * (+18)
08:56:10 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149291&oldid=149287 * Win7HE * (+53) /* Example Programs */
08:57:22 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149292&oldid=149291 * Win7HE * (+54)
09:14:00 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149293&oldid=149292 * Win7HE * (-1) /* (without looping with jumps) Truth Machine */
10:25:02 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=149294&oldid=149293 * Win7HE * (+34)
10:32:21 <esolangs> [[Scratch]] https://esolangs.org/w/index.php?diff=149295&oldid=147638 * Win7HE * (+23)
10:32:45 <esolangs> [[Scratch]] https://esolangs.org/w/index.php?diff=149296&oldid=149295 * Win7HE * (+5)
10:33:17 <esolangs> [[Scratch]] https://esolangs.org/w/index.php?diff=149297&oldid=149296 * Win7HE * (-4)
10:51:06 -!- roper has joined.
12:03:50 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:25 -!- mtm has joined.
12:41:49 -!- ais523 has joined.
12:51:38 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149298&oldid=149151 * PrySigneToFry * (+82)
12:55:49 <esolangs> [[Fusionscript]] https://esolangs.org/w/index.php?diff=149299&oldid=148899 * PrySigneToFry * (+123)
13:04:31 <esolangs> [[Fusionscript]] https://esolangs.org/w/index.php?diff=149300&oldid=149299 * PrySigneToFry * (+448)
13:05:12 <esolangs> [[/compile from Minsky machine]] N https://esolangs.org/w/index.php?oldid=149301 * Jan jelo * (+2452) Created page with "This python program compiles Minsky machine program into program.(Using state 0 means halt,and the program starts from state 1.) <pre> program=''' inc a 2 inc a 3 inc a 4 inc b 5 dec a 4 0 ''' s=lambda x,y:f'/{x}\\/{y}\\' g=lambda x:f'/{x}\\' loop
13:09:35 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149302&oldid=149274 * Kloodi * (+17)
13:09:40 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149303&oldid=149302 * Jan jelo * (+176)
13:40:28 <esolangs> [[Esy]] N https://esolangs.org/w/index.php?oldid=149304 * Win7HE * (+7) Created page with "[[Eso]]"
13:40:55 <esolangs> [[Esy]] https://esolangs.org/w/index.php?diff=149305&oldid=149304 * Win7HE * (+5)
13:41:31 <esolangs> [[Esy]] https://esolangs.org/w/index.php?diff=149306&oldid=149305 * Win7HE * (+5) Redirected page to [[Eso]]
13:45:49 <esolangs> [[User:ZCX islptng/My rate to the user I know]] https://esolangs.org/w/index.php?diff=149307&oldid=148683 * ZCX islptng * (+32)
13:49:24 -!- FreeFull has joined.
13:58:31 <ais523> so today, I did an OS upgrade but it went wrong, and while recovering I had to configure a network interface manually
13:59:05 <ais523> ifconfig to bring it up, dhcpcd to get an IP address, but when trying to set up DNS, things went wrong in a somewhat eso way
13:59:43 <ais523> I was trying to use systemd's resolvectl to set a DNS server, but when I ran resolvectl, the setting generally only lasted a second or so, sometimes less
13:59:53 <ais523> and would go back to having no DNS server almost immediately
14:00:28 <ais523> eventually I fixed it by writing a small script that ran resolvectl every 0.1 seconds in a loop, which held the DNS settings stable for long enough to actually download the packages I needed to complete the update
14:01:07 <int-e> Hmmm. So would dhcp give you wrong DNS servers or is there a third mechanism involved somewhere?
14:01:26 <int-e> But yeah, that sounds like a fun workaround.
14:01:48 <ais523> there were no DNS servers being given at all
14:02:31 <ais523> (also this is the first time I've used wired Internet in probably over a decade – trying to figure out how to do it wirelessly would have been even harder)
14:03:02 <int-e> I made a fresh system image for my raspberry over New Year's so there was some network configuration in that too. Nothing adverserial though unless you count the fact that as far as I can see, isc-dhcpd is no longer there, and udhcpd has its own set of quirks.
14:04:21 -!- amby has joined.
14:05:18 <b_jonas> I don't understand how network configuration with dhcp works at all on linux these days
14:05:58 <ais523> well whatever opaque magic normally does it wasn't installed at the time
14:06:27 <ais523> AFAICT, apt got a fraction of the way through the upgrade and then gave up, but most of what it did in the fraction that it completed was uninstalling things
14:07:19 <int-e> I expected udhcpd to default to class-based routing so 192.168.0.1 would come with a /24 netmask... well it gave out a 255.0.0.0 instead. Which happens to work for this setup but I still fixed it. ;-)
14:07:42 <ais523> as long as you don't need to access any other addresses in 192/8 :-)
14:08:01 <ais523> (what even is there, is it just regular addresses outside 192.168/16?)
14:08:42 <int-e> it would probably even work for that... because raspberry (= router) side the netmasks were correct and 192.168.0.1 is my default gateway.
14:10:40 <int-e> It would try to send directly instead of via 192.168.0.1. Still the same link though, and the router would see the packet. So it's murky territory.
14:11:38 <b_jonas> this is the second time recently that I heard of an interrupted OS upgrade going bad
14:11:41 <int-e> I still think it would work because of the same link thing.
14:13:00 <int-e> (But would break the moment I'd add a switch.)
14:14:01 <ais523> b_jonas: it's happened before to me but never quite this badly
14:14:18 <ais523> I think last time I still had working networking so I was able to recover before rebooting
14:14:25 <int-e> Oh, no. The computer *should* try ARP to find the MAC address and that would fail, right?
14:16:59 <b_jonas> in such a case, can you boot from a standalone installer disk and use that to access the package database of the existing system and update the OS that way, without depending on most of what's installed in it?
14:17:45 <ais523> b_jonas: that was my plan B
14:18:21 <ais523> but it would take a while to find a standalone installer, I think I have an old one *somewhere* around here but it would take ages to find, and it is hard to make a new one without networking
14:20:54 <b_jonas> I do have one of those disks around, though I should probably burn a more recent one
14:21:39 <ais523> you can use USB sticks rather than CDs
14:21:45 <ais523> I have to do it like that because my laptop doesn't have a CD drive
14:22:09 <ais523> CDs will give you compatibility to older computers but that usually isn't important unless you're trying to give new life to a computer that's otherwise obsolete
14:22:10 <b_jonas> also if I have a bootloader intact and the filesystem isn't horribly corrupted and I have internet (three big ifs) then I can boot the netboot installer from hard disk (I've done that before) since that is bootable as only a kernel and a small initrd, two files
14:22:33 <b_jonas> and I have done the same with a bootloader from a CD but the two files on hard disk too
14:22:50 <ais523> I had intact bootloader, non-corrupted root filesystem but the others weren't mounting, and most of the networking-related packages weren't installed
14:23:35 <ais523> (I fixed the non-mounting filesystems problem by installing udev, which fortunately was in the package cache at the time – the installer pre-loads the package cache with packages it thinks it will need, it made a good decision with that one)
14:30:02 <int-e> Hmm, which distribution is that?
14:36:23 <int-e> Okay. So /maybe/ Debian is fine :)
14:39:51 <ais523> the reason why it gave up was also strange, something went wrong configuring emacs
14:40:09 <ais523> emacs is unlikely to be essential to the upgrade, so you'd expect the installer to just temporarily deconfigure it during the upgrade
14:40:18 <ais523> or, well, treat it as half-deconfigured
14:40:57 <ais523> that's what a purely apt+dpkg-based upgrade would do, but apparently Ubuntu was doing something different
14:41:40 <b_jonas> yeah, emacs shouldn't be load-bearing during an upgrade
14:44:08 <ais523> apt in general was struggling with the half-configured state, I ended up manually uninstalling emacs and everything that depends on it with dpkg
14:44:17 <ais523> to remove the inconsistency
14:44:22 <ais523> (I reinstalled it afterwards)
14:50:40 -!- lynndotpy6 has quit (Quit: bye bye).
14:51:26 -!- lynndotpy6 has joined.
14:54:26 -!- Sgeo has joined.
14:55:38 <esolangs> [[User:Tommyaweosme/sandbox]] https://esolangs.org/w/index.php?diff=149308&oldid=131101 * Tommyaweosme * (+47)
15:16:10 -!- fowl has quit (Read error: Connection reset by peer).
15:16:48 -!- fowl has joined.
15:36:38 <esolangs> [[Talk:Python But WORST!!]] N https://esolangs.org/w/index.php?oldid=149309 * Tommyaweosme * (+345) Created page with "little-known fact: chromeos exists, what does it do on my computer? ~~~~"
15:57:04 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:27:51 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149310&oldid=149298 * 47 * (+56) /* Example */
16:29:45 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149311&oldid=149310 * 47 * (-9) /* Example */
16:30:02 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149312&oldid=149311 * 47 * (+1) /* Example */
16:32:25 -!- tromp has joined.
16:35:46 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=149313&oldid=148840 * 47 * (+81) /* Hello, world! */
16:35:55 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=149314&oldid=149313 * 47 * (+2) /* Implementations */
17:05:43 -!- Sgeo has quit (Read error: Connection reset by peer).
17:05:59 -!- Sgeo has joined.
17:08:19 -!- roper has quit (Read error: Connection reset by peer).
17:14:20 -!- roper has joined.
17:29:44 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:27:27 -!- tromp has joined.
18:30:43 -!- Lord_of_Life_ has joined.
18:31:17 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:33:39 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
19:04:54 <esolangs> [[Underload/a interpreter in Uiua]] N https://esolangs.org/w/index.php?oldid=149315 * Jan jelo * (+986) Created page with "This is a [[Underload]] interpreter in Uiua written by [[User:Jan jelo]] <pre> C ::{} State C0{"aa""b""c"} I 0 S 1 P 2 # * (Join) J C I::2:0:1..S.:1P. # a (A) A C I::1:$"(_)"0.S.:1P. # ~ (Flip) F C I:{}1:0.:2.S.:1P. # : (D
19:06:04 <esolangs> [[Underload]] https://esolangs.org/w/index.php?diff=149316&oldid=149150 * Jan jelo * (+58) /* External resources */
19:07:31 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149317&oldid=149180 * Jan jelo * (+37) /* Intepreters */
19:12:35 <esolangs> [[User:Jan jelo/a BF interpreter in Uiua]] N https://esolangs.org/w/index.php?oldid=149318 * Jan jelo * (+1471) Created page with "This is a [[Brainfuck]] interpreter in Uiua written by [[User:Jan jelo]]. <pre class="rectwrap"> P ( 0@+ | 1@- | 2@< | 3@> | 4@[ | 5@] | 6@. | 7@, | 8 ) Init { "\0" "\0" 0 } Lt 0 Rt 1 Pc 2 Pg 3 Op :Pg:Pc. Cur Lt Th (P
19:17:00 -!- __monty__ has joined.
19:18:34 <esolangs> [[Underload/a interpreter in python]] https://esolangs.org/w/index.php?diff=149319&oldid=149133 * Jan jelo * (+22)
19:18:35 -!- roper has quit (Read error: Connection reset by peer).
19:20:22 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149320&oldid=149317 * Jan jelo * (+44) /* Intepreters */
19:24:04 <esolangs> [[Brainfuck]] https://esolangs.org/w/index.php?diff=149321&oldid=149104 * Jan jelo * (+63) /* Python interpreters */
19:24:18 -!- roper has joined.
19:25:06 <esolangs> [[Brainfuck]] M https://esolangs.org/w/index.php?diff=149322&oldid=149321 * Jan jelo * (+1) /* Python interpreters */
19:29:07 <esolangs> [[Brainfuck]] https://esolangs.org/w/index.php?diff=149323&oldid=149322 * Jan jelo * (+41) /* Python interpreters */
19:45:28 <esolangs> [[User:Jan jelo/a BF interpreter in Haskell]] N https://esolangs.org/w/index.php?oldid=149324 * Jan jelo * (+2386) Created page with "This is a [[Brainfuck]] interpreter in Haskell written by [[User:Jan jelo]]. <pre calss="rectwrap"> import Data.Char (chr,ord) main = run (filter(\x->any(==x)"+-<>.,[]")pgrm) 0 (Tape(Stack[])(Stack[])) 0 0 pgrm="++++++++++[>+++++++>+++
19:46:19 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149325&oldid=149320 * Jan jelo * (+47) /* Intepreters */
19:50:29 <esolangs> [[Brainfuck]] https://esolangs.org/w/index.php?diff=149326&oldid=149323 * Jan jelo * (+77) /* Haskell interpreters */
19:55:53 -!- roper has quit (Quit: prezzz).
20:00:44 <esolangs> [[User:Jan jelo/a BF interpreter in Haskell]] https://esolangs.org/w/index.php?diff=149327&oldid=149324 * Jan jelo * (+44)
20:02:31 <esolangs> [[Pyline]] https://esolangs.org/w/index.php?diff=149328&oldid=149087 * Corbin * (+37) I suppose that it's only obvious that this is easy mode...
20:03:10 <esolangs> [[User:Jan jelo/a BF interpreter in Haskell]] https://esolangs.org/w/index.php?diff=149329&oldid=149327 * Jan jelo * (-49)
20:08:42 <esolangs> [[Pyline Classic]] N https://esolangs.org/w/index.php?oldid=149330 * Corbin * (+2030) ...if there's also a hard mode available.
20:09:55 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149331&oldid=148835 * 47 * (+0) /* Stuff to continue */
20:21:43 <esolangs> [[Brainfuck]] https://esolangs.org/w/index.php?diff=149332&oldid=149326 * Jan jelo * (-78) /* Notable implementations */
20:25:39 <esolangs> [[Brainfuck implementations]] https://esolangs.org/w/index.php?diff=149333&oldid=145135 * Jan jelo * (+141) /* Normal implementations */
20:26:27 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=149334&oldid=149314 * Ractangle * (-10) /* Syntax */
20:27:22 <esolangs> [[Brainfuck implementations]] https://esolangs.org/w/index.php?diff=149335&oldid=149333 * Jan jelo * (+0) /* Normal implementations */
20:28:18 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=149336&oldid=149334 * Ractangle * (+66) /* Implementations */
20:28:53 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=149337&oldid=148839 * Ractangle * (-1) /* Esolangs */
20:53:32 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=149338&oldid=148170 * Ractangle * (-16) /* Truth-machine */
20:54:22 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=149339&oldid=149338 * Ractangle * (+12) /* Truth-machine */
20:55:14 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=149340&oldid=149339 * Ractangle * (+0) 1*
20:56:37 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=149341&oldid=149340 * Ractangle * (-7) /* Truth-machine */
21:02:06 <esolangs> [[User:Aadenboy/Template:Sandbox]] N https://esolangs.org/w/index.php?oldid=149342 * Aadenboy * (+134) Created page with "<includeonly>{{#{{{1|}}}:{{{2|}}}|{{{3|}}}|{{{4|}}}|{{{5|}}}}}</includeonly><noinclude>{{User:Aadenboy/Template:Sandbox|ifeq|a|b|c|d}}"
21:02:11 <esolangs> [[Track!]] https://esolangs.org/w/index.php?diff=149343&oldid=149220 * Ractangle * (+20)
21:02:27 <esolangs> [[Track!]] https://esolangs.org/w/index.php?diff=149344&oldid=149343 * Ractangle * (+0)
21:03:31 <esolangs> [[2025!]] https://esolangs.org/w/index.php?diff=149345&oldid=149135 * Ractangle * (+2)
21:05:23 -!- craigo has quit (Quit: Leaving).
21:31:03 -!- Everything has joined.
21:51:56 <korvo> Taking a break from Lojban ontology today to show the youngsters how to Pyline properly. I have hacked up what I think is my smallest, slowest BF interp yet: https://gist.github.com/MostAwesomeDude/d0559414ace589c0536b219d2e086db7
21:52:17 <korvo> I'm about halfway through converting this to Pyline Classic but I need to recharge.
21:53:09 <korvo> I really wanted to avoid using a fixed-point combinator but I think that my options are: Z combinator for Python, locals() hacks, or bytecode with code() to hand-write a while-loop.
21:58:50 <ais523> I wonder whether that's faster or slower than my BF interpreter in Esimpl
21:59:23 <ais523> although mine was implementing bignum BF, yours can easily be adapted to that
22:00:40 <ais523> (it ships with the Esimpl interpreter linked on the wiki, maybe I should make it a separate link)
22:05:50 <b_jonas> ais523: don't you have double exponentially slow bf interpreters for one of these machines with only counters?
22:17:48 <ais523> possibly, although I'm not sure I ever actually wrote one
22:18:06 <ais523> I thought Esimpl would be an interesting comparison because the interpreter isn't hugely slow, but it is limited by having only stacks to store data in
22:18:57 <ais523> if you pick a super-slow language it isn't an interesting comparison
22:22:51 <int-e> So you can have 2 stacks for data and 2 stacks for tracking the program and one more stack for tracking loop depth while skipping back and forth?
22:23:40 <int-e> (trying to wrap my head around the utility of having more than 2 stacks... this kind of separation of concerns should help)
22:24:36 <ais523> it's implemented Underload-style, two for data, one for program, one for holding the current loop while making a copy of it (which is a full semideque not just a stack as it gets looped round twice), and one for counting nesting depth
22:24:48 <ais523> and one as a temporary while lexing
22:32:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:59:45 <esolangs> [[User:Waffelz]] https://esolangs.org/w/index.php?diff=149346&oldid=149098 * Waffelz * (-21)
23:52:27 -!- Everything has quit (Quit: leaving).
23:58:01 -!- __monty__ has quit (Quit: leaving).
00:03:57 -!- mtm has quit (Ping timeout: 252 seconds).
00:06:19 -!- mtm has joined.
01:48:38 <korvo> Well, I failed. I have a pile of code: https://bpa.st/LNJHYYC2ITORTPJT54NYCEAGXM
01:49:12 <korvo> It doesn't work. Or maybe it works? But it causes key errors that should be impossible on Lost Kingdom, which means I fucked something up in a dire way. Maybe the parser's shit.
01:49:49 <korvo> I can't get it to actually print out any non-trivial looping construct. mandel.b pegs my CPU and doesn't achieve anything.
01:50:31 <korvo> Anyway, good waste of an afternoon. Maybe there's something to learn from this.
01:57:31 -!- ais523 has quit (Quit: quit).
02:11:27 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:17:38 <esolangs> [[Python But WORST, at least in Esolang Wiki]] https://esolangs.org/w/index.php?diff=149347&oldid=149312 * PrySigneToFry * (+89)
04:00:41 <esolangs> [[User talk:Ractangle]] https://esolangs.org/w/index.php?diff=149348&oldid=148833 * PrySigneToFry * (+1128) /* Your username */ new section
04:02:51 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=149349&oldid=148142 * PrySigneToFry * (-23007) Clear the talking page
04:03:32 <esolangs> [[User:PrySigneToFry/Archive/2024 9 20 to 2025 1 4]] N https://esolangs.org/w/index.php?oldid=149350 * PrySigneToFry * (+23201) Archived
04:04:05 <esolangs> [[User:PrySigneToFry/Archive]] https://esolangs.org/w/index.php?diff=149351&oldid=139984 * PrySigneToFry * (+28)
04:09:04 <esolangs> [[UserEdited]] https://esolangs.org/w/index.php?diff=149352&oldid=149007 * PrySigneToFry * (+289)
04:09:42 <esolangs> [[UserEdited]] https://esolangs.org/w/index.php?diff=149353&oldid=149352 * PrySigneToFry * (-1)
04:11:12 <esolangs> [[PokBattle]] M https://esolangs.org/w/index.php?diff=149354&oldid=148563 * PrySigneToFry * (+7)
04:52:42 <esolangs> [[Fusionscript]] https://esolangs.org/w/index.php?diff=149355&oldid=149300 * PrySigneToFry * (+99)
05:25:01 -!- craigo has joined.
05:30:32 <esolangs> [[TapeFuck]] M https://esolangs.org/w/index.php?diff=149356&oldid=147869 * PythonshellDebugwindow * (+94) Categories
05:32:38 <esolangs> [[Queue-based esolang]] M https://esolangs.org/w/index.php?diff=149357&oldid=148160 * PythonshellDebugwindow * (+104) Categories
05:34:06 <esolangs> [[Def run(t):]] M https://esolangs.org/w/index.php?diff=149358&oldid=148033 * PythonshellDebugwindow * (+14) Lowercase
05:37:30 <esolangs> [[GotoLang]] M https://esolangs.org/w/index.php?diff=149359&oldid=148201 * PythonshellDebugwindow * (+92) Categories
05:38:49 <esolangs> [[BrainfXX]] M https://esolangs.org/w/index.php?diff=149360&oldid=136886 * PythonshellDebugwindow * (+38) See also
05:41:16 <esolangs> [[The Genetic Computer]] M https://esolangs.org/w/index.php?diff=149361&oldid=148441 * PythonshellDebugwindow * (+66) Categories
05:43:06 <esolangs> [[Albuquerque challenge/exampled to itself]] M https://esolangs.org/w/index.php?diff=149362&oldid=148244 * PythonshellDebugwindow * (+32) Back
05:58:23 <esolangs> [[Brainrot]] https://esolangs.org/w/index.php?diff=149363&oldid=148267 * PythonshellDebugwindow * (+102) Disambiguation
06:00:11 <esolangs> [[Brainrot (Yayimhere)]] M https://esolangs.org/w/index.php?diff=149364&oldid=148273 * PythonshellDebugwindow * (+163) Lowercase, categories
06:00:44 <esolangs> [[Brainrot]] M https://esolangs.org/w/index.php?diff=149365&oldid=149363 * PythonshellDebugwindow * (+0) Capitalisation
06:04:04 <esolangs> [[Brainrot (Theothetruenerd)]] https://esolangs.org/w/index.php?diff=149366&oldid=148265 * PythonshellDebugwindow * (+152) Categories, see also
06:05:06 <esolangs> [[Gen Alpha]] M https://esolangs.org/w/index.php?diff=149367&oldid=133257 * PythonshellDebugwindow * (+87) See also
06:06:30 <esolangs> [[Gen Alpha Brainrot]] M https://esolangs.org/w/index.php?diff=149368&oldid=133258 * PythonshellDebugwindow * (+78) See also
06:07:26 <esolangs> [[Rizzlang]] M https://esolangs.org/w/index.php?diff=149369&oldid=136621 * PythonshellDebugwindow * (+89) See also
06:10:47 <esolangs> [[16x16 RGB2 panel]] M https://esolangs.org/w/index.php?diff=149370&oldid=148296 * PythonshellDebugwindow * (+66) Categories
06:14:39 <esolangs> [[User:Waffelz]] https://esolangs.org/w/index.php?diff=149371&oldid=149346 * Waffelz * (+10)
06:28:29 <esolangs> [[Mobius brainfuck]] https://esolangs.org/w/index.php?diff=149372&oldid=148290 * PythonshellDebugwindow * (+758) Link, interpreter, categories
06:30:49 <esolangs> [[Mutual Modification Machine]] M https://esolangs.org/w/index.php?diff=149373&oldid=148325 * PythonshellDebugwindow * (+68) Link, header, categories
06:35:37 <esolangs> [[TuringLang]] M https://esolangs.org/w/index.php?diff=149374&oldid=148390 * PythonshellDebugwindow * (+63) Wikilink, categories
06:43:19 <esolangs> [[Halting problem (language)]] M https://esolangs.org/w/index.php?diff=149375&oldid=148351 * PythonshellDebugwindow * (+121) Categories
06:50:51 <esolangs> [[Brainstack]] M https://esolangs.org/w/index.php?diff=149376&oldid=74712 * PythonshellDebugwindow * (+57) Distinguish confusion
06:56:14 <esolangs> [[Brainstack(islptng)]] M https://esolangs.org/w/index.php?diff=149377&oldid=148516 * PythonshellDebugwindow * (+118) Categories
06:57:19 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149378&oldid=147888 * PythonshellDebugwindow * (+49) Distinguish confusion
07:06:48 <esolangs> [[Directions]] M https://esolangs.org/w/index.php?diff=149379&oldid=148707 * PythonshellDebugwindow * (+205) Categories
07:17:28 <esolangs> [[Brainstack(islptng)]] https://esolangs.org/w/index.php?diff=149380&oldid=149377 * ZCX islptng * (-2) Wrong category!
08:19:56 -!- tromp has joined.
09:22:43 -!- __monty__ has joined.
09:40:33 <esolangs> [[Constructible]] N https://esolangs.org/w/index.php?oldid=149381 * Hakerh400 * (+1481) +[[Constructible]]
09:41:03 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149382&oldid=149275 * Hakerh400 * (+20) +[[Constructible]]
09:41:20 <esolangs> [[User:Hakerh400]] https://esolangs.org/w/index.php?diff=149383&oldid=144748 * Hakerh400 * (+20) +[[Constructible]]
09:47:56 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:50:54 -!- tromp has joined.
10:53:15 -!- craigo has quit (Ping timeout: 252 seconds).
11:05:05 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=149384&oldid=149112 * Jan jelo * (+832)
11:11:33 -!- ais523 has joined.
11:24:45 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=149385&oldid=149384 * Jan jelo * (+657)
11:25:31 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=149386&oldid=149385 * Jan jelo * (+13) /* Looping */
11:27:25 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=149387&oldid=149386 * Jan jelo * (+13) /* Looping */
11:35:24 -!- Everything has joined.
11:37:15 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149388&oldid=149325 * Jan jelo * (+1) /* Article */
12:03:43 -!- mtm has quit (Ping timeout: 244 seconds).
12:04:51 -!- mtm has joined.
12:24:12 -!- FreeFull has quit.
12:26:41 -!- Sgeo has quit (Read error: Connection reset by peer).
13:18:38 -!- FreeFull has joined.
13:58:18 -!- molson_ has joined.
14:01:39 -!- molson has quit (Ping timeout: 276 seconds).
14:47:22 -!- amby has joined.
15:36:55 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:00:03 -!- ais523 has quit (Quit: quit).
16:06:37 -!- ais523 has joined.
16:12:41 -!- tromp has joined.
16:34:24 -!- Everything has quit (Quit: leaving).
16:44:39 -!- Artea has quit (Quit: ZNC 1.9.1 - https://znc.in).
16:59:13 -!- Artea has joined.
17:07:18 <esolangs> [[Special:Log/newusers]] create * Juanp32 * New user account
17:10:19 -!- ais523 has quit (Ping timeout: 264 seconds).
17:32:04 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149389&oldid=149219 * Juanp32 * (+681) /* Introductions */
17:36:32 <esolangs> [[User:Juanp32]] N https://esolangs.org/w/index.php?oldid=149390 * Juanp32 * (+307) making userpage :)
17:42:31 -!- chiselfuse has quit (Remote host closed the connection).
17:45:28 -!- ais523 has joined.
17:47:45 -!- chiselfuse has joined.
17:56:36 <esolangs> [[Array?]] https://esolangs.org/w/index.php?diff=149391&oldid=146013 * 47 * (-64) /* Commands */
17:56:57 <esolangs> [[Array?]] https://esolangs.org/w/index.php?diff=149392&oldid=149391 * 47 * (+8) /* Commands */
17:59:21 <esolangs> [[Definition]] https://esolangs.org/w/index.php?diff=149393&oldid=148522 * 47 * (-1) /* Syntax */
18:06:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:07:04 <esolangs> [[Definition]] https://esolangs.org/w/index.php?diff=149394&oldid=149393 * 47 * (+167) /* Hello, world! */
18:10:23 <esolangs> [[Definition]] https://esolangs.org/w/index.php?diff=149395&oldid=149394 * 47 * (+92) /* Syntax */
18:21:24 -!- rodgort has quit (Quit: Leaving).
18:21:48 <esolangs> [[!aBF']] https://esolangs.org/w/index.php?diff=149396&oldid=144515 * 47 * (-1) golfed the truth-machine a bit more
18:23:15 <esolangs> [[!lyriclydemoteestablishcommunism!]] https://esolangs.org/w/index.php?diff=149397&oldid=148748 * 47 * (-70) the batch implementation has output
18:24:04 -!- rodgort has joined.
18:24:25 <esolangs> [[!aBF']] https://esolangs.org/w/index.php?diff=149398&oldid=149396 * 47 * (+1) /* Examples */
18:25:40 <esolangs> [[!]] https://esolangs.org/w/index.php?diff=149399&oldid=141357 * 47 * (+0) /* Syntax */
18:25:54 <esolangs> [[!]] https://esolangs.org/w/index.php?diff=149400&oldid=149399 * 47 * (+0) /* Truth-machine */
18:26:30 <esolangs> [[!]] https://esolangs.org/w/index.php?diff=149401&oldid=149400 * 47 * (+1) /* Syntax */
18:30:58 -!- Lord_of_Life_ has joined.
18:32:42 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:33:53 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:36:41 <esolangs> [[Queue-based esolang]] https://esolangs.org/w/index.php?diff=149402&oldid=149357 * 47 * (+57) /* Interpreters */
18:41:23 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149403&oldid=138739 * 47 * (-34) /* Infinite loop */
18:42:51 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149404&oldid=149403 * 47 * (-287) /* Truth-machine */
18:43:15 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149405&oldid=149404 * 47 * (-22) /* Commands */
18:45:37 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149406&oldid=149405 * 47 * (-125) /* Examples */
18:46:38 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149407&oldid=149406 * 47 * (+68) /* Commands */
18:49:04 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149408&oldid=149407 * 47 * (-22)
18:49:22 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149409&oldid=149408 * 47 * (-8) /* Commands */
18:54:02 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149410&oldid=149409 * 47 * (+35) /* Commands */
18:55:39 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149411&oldid=149410 * 47 * (-44) /* Commands */
19:02:36 -!- tromp has joined.
19:12:06 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:37:05 <zzo38> Is there a way in GNU C to tell the compiler that a specific constant is that the compiler can assume that it remains constant while the program is running but is not allowed to assume what its value is at compile time (possibly because the value will be changed in the executable file before the program runs)?
19:42:37 <b_jonas> zzo38: yes, I think if you declare a global variable as const then the compiler is allowed to assume that its value can't be changed but you can still use an initializer whose value isn't known at compiler time, such as a function call
19:43:01 <b_jonas> in fact I think that works even for local variables
19:44:49 <b_jonas> but the actual object has to be declared const, just a const pointer doesn't guarantee that what it's pointing to can't change
19:45:24 <zzo38> For local variables that will make sense, but I mean whose value is initialized before the program runs (how this is done is not necessarily known to the compiler; one way would be modifying the executable file by something other than the compiler), so it is not initialized by a function call or something like that.
19:46:16 <korvo> You can give it `extern` linkage while preserving the `const` modifiers. IIRC this is the right way to do it; you could pretend that the value is known to the linker but not the compiler.
19:47:33 <korvo> If the goal is to force the compiler to not do `volatile` or PLT reads all the time, though, I'm not sure. It'd definitely be a GNU-specific extension that I haven't seen before.
19:48:37 <b_jonas> zzo38: if the object isn't large then you could just make a copy into a const variable and use that copy
19:49:16 <b_jonas> but I don't think the compiler can do much global optimizations about the value being constant anyway
19:49:35 <b_jonas> there was also a relevant function attribute I think
19:50:04 -!- tromp has joined.
19:51:45 <b_jonas> https://gcc.gnu.org/onlinedocs/gcc-14.2.0/gcc/Common-Function-Attributes.html#index-const-function-attribute
19:52:00 <b_jonas> the return value of such a function can't change throughout the program
19:52:05 <b_jonas> but that too only helps for small objects
20:06:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:30:16 -!- Everything has joined.
20:36:44 -!- Sgeo has joined.
20:47:40 -!- tromp has joined.
21:01:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:09:52 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
21:09:53 <zemhill> ais523.two_thirds: points 15.10, score 40.33, rank 3/47
21:12:50 <ais523> two_thirds has a very similar win/loss profile to impatience2, because it's in the same general group of strategies, but should be more stable (impatience2 can be exploited by making a large change to your flag, two_thirds can't be)
21:19:14 -!- tromp has joined.
21:29:15 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:40:04 -!- tromp has joined.
22:01:29 <esolangs> [['interbasic]] https://esolangs.org/w/index.php?diff=149412&oldid=149411 * Ractangle * (+6) /* Truth-machine */
22:05:11 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149413&oldid=149068 * Ractangle * (+153) /* $+-? */
22:47:34 <esolangs> [[Sakana]] https://esolangs.org/w/index.php?diff=149414&oldid=133735 * TheCanon2 * (+230) Added warning
22:48:13 -!- __monty__ has quit (Quit: leaving).
23:08:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:11:14 -!- tromp has joined.
23:11:59 -!- Everything has quit (Quit: leaving).
23:20:35 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] N https://esolangs.org/w/index.php?oldid=149415 * Jan jelo * (+4013) Created page with "This python program by [[User:Jan jelo]] compiles Minsky machine program into [[Blindfolded Arithmetic]] program.(using state 0 means halt,states start from state 1.) It uses <code>2^a*3^b</code> to encode two counters in <cod
23:24:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:24:23 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] https://esolangs.org/w/index.php?diff=149416&oldid=149415 * Jan jelo * (+43)
23:25:32 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] https://esolangs.org/w/index.php?diff=149417&oldid=149416 * Jan jelo * (+17)
23:25:54 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] https://esolangs.org/w/index.php?diff=149418&oldid=149417 * Jan jelo * (+0)
23:26:34 <esolangs> [[User:Jan jelo/a BF interpreter in Haskell]] https://esolangs.org/w/index.php?diff=149419&oldid=149329 * Jan jelo * (+0)
23:27:15 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=149420&oldid=149086 * TheCanon2 * (+157) added debug version
23:28:46 <esolangs> [[User talk:Waffelz]] https://esolangs.org/w/index.php?diff=149421&oldid=149127 * Waffelz * (+86) /* waffelz' Talk Page */
23:57:07 <esolangs> [[Blindfolded Arithmetic]] https://esolangs.org/w/index.php?diff=149422&oldid=142352 * Jan jelo * (+1206) /* Proof of Turing-completeness */
00:00:17 <esolangs> [[Blindfolded Arithmetic]] https://esolangs.org/w/index.php?diff=149423&oldid=149422 * Jan jelo * (+6) /* Compile from Minsky machine */
00:03:08 -!- mtm has quit (Ping timeout: 252 seconds).
00:03:47 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] https://esolangs.org/w/index.php?diff=149424&oldid=149418 * Jan jelo * (+681)
00:05:13 -!- mtm has joined.
00:09:01 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] https://esolangs.org/w/index.php?diff=149425&oldid=149424 * Jan jelo * (+6)
00:20:29 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149426&oldid=149388 * Jan jelo * (+158)
00:21:09 <esolangs> [[/compile from Minsky machine]] M https://esolangs.org/w/index.php?diff=149427&oldid=149301 * Jan jelo * (+21)
00:24:53 <esolangs> [[/compile from Minsky machine]] M https://esolangs.org/w/index.php?diff=149428&oldid=149427 * Jan jelo * (+4)
00:30:24 <esolangs> [[User:Jan jelo]] M https://esolangs.org/w/index.php?diff=149429&oldid=149426 * Jan jelo * (+23)
00:30:41 <esolangs> [[User:Jan jelo]] M https://esolangs.org/w/index.php?diff=149430&oldid=149429 * Jan jelo * (+1)
00:37:19 <esolangs> [[Pyline]] https://esolangs.org/w/index.php?diff=149431&oldid=149328 * Jan jelo * (+57) /* Brainfuck interpreter */
00:54:50 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] M https://esolangs.org/w/index.php?diff=149432&oldid=149425 * Jan jelo * (-52)
01:17:24 <esolangs> [[Blindfolded Arithmetic/compile from Minsky machine]] M https://esolangs.org/w/index.php?diff=149433&oldid=149432 * Jan jelo * (+3)
01:49:14 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=149434&oldid=148347 * Jan jelo * (+87) /* Real Quines */
02:12:32 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:20:44 <esolangs> [[Pytecode]] N https://esolangs.org/w/index.php?oldid=149435 * BestCoder * (+306) Created page with "Python bytecode == examples == === hello world === 3 0 LOAD_GLOBAL 0 (print) 2 LOAD_CONST 1 ('hello world') 4 CALL_FUNCTION 1 6 POP_TOP 8 LOAD_CONST
02:31:48 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=149436&oldid=149434 * Jan jelo * (+2358) /* Python (Python 3) */
02:34:56 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=149437&oldid=149436 * Jan jelo * (+0) /* Python (Python 3) */
03:05:04 -!- op_4 has quit (Remote host closed the connection).
03:05:22 -!- tromp has joined.
03:05:35 -!- op_4 has joined.
03:06:34 -!- tromp has quit (Client Quit).
03:28:21 <esolangs> [[Direction]] https://esolangs.org/w/index.php?diff=149438&oldid=138338 * BestCoder * (+4) /* 321 program */
03:28:44 <esolangs> [[Direction]] https://esolangs.org/w/index.php?diff=149439&oldid=149438 * BestCoder * (+0) /* 321 program */
04:11:07 -!- ais523 has quit (Quit: quit).
04:45:44 <esolangs> [[Tictactoe]] https://esolangs.org/w/index.php?diff=149440&oldid=133617 * BestCoder * (+176)
04:46:56 <zzo38> The new calendar for this year does not have seasons
04:49:05 <esolangs> [[Tictactoe]] https://esolangs.org/w/index.php?diff=149441&oldid=149440 * BestCoder * (+223)
06:49:36 <esolangs> [[User:Tommyaweosme/BRING BACK THE OLD SANDBOX]] https://esolangs.org/w/index.php?diff=149442&oldid=149110 * PrySigneToFry * (+70)
07:16:58 -!- tromp has joined.
07:28:29 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
07:47:32 -!- tromp has joined.
08:17:58 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
08:27:11 -!- craigo has joined.
08:28:31 -!- tromp has joined.
08:42:54 -!- tromp has quit (Quit: Textual IRC Client: www.textualapp.com).
08:43:20 -!- tromp has joined.
08:58:17 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:13:25 -!- lisbeths has joined.
09:57:31 -!- tromp has joined.
10:06:52 <esolangs> [[Special:Log/move]] move * 47 * moved [[Hashmark]] to [[ITECAAPL]]
10:07:55 <esolangs> [[ITECAAPL]] https://esolangs.org/w/index.php?diff=149445&oldid=149443 * 47 * (+35)
10:25:48 <esolangs> [[Ilo nanpa sitelen]] N https://esolangs.org/w/index.php?oldid=149446 * EvyLah * (+406) create base page but I need to finish it later
10:25:56 <esolangs> [[Ilo nanpa sitelen]] M https://esolangs.org/w/index.php?diff=149447&oldid=149446 * EvyLah * (-1)
10:27:58 -!- __monty__ has joined.
10:42:21 <esolangs> [[OmegaLang]] N https://esolangs.org/w/index.php?oldid=149448 * PrySigneToFry * (+8725) Created page with "OmegaLang is designed by PSTF. = Language Overview = OmegaLang is an object-oriented programming language that uses non-extreme-esoteric syntax to programming. It is powerful, and easy to learn but hard to complete mastery its principle. The language most inspi
10:49:18 <esolangs> [[User talk:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]] https://esolangs.org/w/index.php?diff=149449&oldid=149082 * PrySigneToFry * (+783)
10:51:37 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149450&oldid=145256 * PrySigneToFry * (+429)
10:53:38 <esolangs> [[User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=149451&oldid=148424 * PrySigneToFry * (+441) /* To get code-golfing, I recommend to use the Base-100. */ new section
10:58:32 -!- Sgeo has quit (Read error: Connection reset by peer).
11:01:16 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149452&oldid=149413 * PrySigneToFry * (+176)
11:05:07 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149453&oldid=131339 * PrySigneToFry * (+286)
11:10:17 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149454&oldid=149453 * PrySigneToFry * (+451) Both type 12 and type 13 are designed and implemented by PSTF.
11:11:15 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149455&oldid=149454 * PrySigneToFry * (-8) Fixed interpreter
11:13:18 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149456&oldid=149455 * PrySigneToFry * (+18)
11:15:37 -!- FreeFull has quit (Ping timeout: 244 seconds).
11:17:36 -!- FreeFull has joined.
11:31:45 <esolangs> [[JCLN]] https://esolangs.org/w/index.php?diff=149457&oldid=125659 * Kaveh Yousefi * (+205) Introduced an examples section whose incipial member constitutes an odd-numbered line jumper.
11:32:22 <esolangs> [[JCLN]] https://esolangs.org/w/index.php?diff=149458&oldid=149457 * Kaveh Yousefi * (+157) Added a hyperlink to my implementation of the JCLN programming language on GitHub and altered the Unimplemented category tag to Implemented.
11:38:27 -!- tromp has quit (Read error: Connection reset by peer).
12:02:30 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:15 -!- mtm has joined.
12:18:54 -!- FreeFull has quit.
12:19:09 -!- FreeFull has joined.
12:30:52 -!- tromp has joined.
12:38:31 <APic> Celebrate Mungday! Hail Eris! 😇
13:46:42 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149459&oldid=149382 * PrySigneToFry * (+16) /* O */
13:51:08 -!- perlbot has quit (Ping timeout: 244 seconds).
13:52:45 -!- simcop2387 has quit (Ping timeout: 260 seconds).
13:53:30 <esolangs> [[+]] https://esolangs.org/w/index.php?diff=149460&oldid=141272 * PrySigneToFry * (+119)
13:59:28 <esolangs> [[Anti-Plushie language/PSTF]] N https://esolangs.org/w/index.php?oldid=149461 * PrySigneToFry * (+565) Created page with "PSTF also have another APL(Anti-Plushie Language, not that APL). == Commands == It is same as brainfuck, except: # If your program contains <code>.</code>, then output <code></code> then terminate. # If your program lets a cell to be 2 or 50, th
14:00:39 <esolangs> [[User:PrySigneToFry/ constant]] M https://esolangs.org/w/index.php?diff=149462&oldid=142259 * PrySigneToFry * (-2)
14:01:52 <esolangs> [[PrySigneToFry-complete]] https://esolangs.org/w/index.php?diff=149463&oldid=142264 * PrySigneToFry * (+103)
14:06:33 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149464&oldid=149331 * 47 * (+25) /* Tommyawsome */
14:07:04 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149465&oldid=149464 * 47 * (-43) /* Tommyawsome */
14:08:36 -!- simcop2387 has joined.
14:09:56 -!- perlbot has joined.
14:17:26 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=149466&oldid=148357 * 47 * (+66)
14:17:38 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=149467&oldid=149466 * 47 * (-1)
14:21:08 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=149468&oldid=149467 * 47 * (-1) /* Python3 */
14:32:56 -!- Everything has joined.
14:36:35 -!- Everything has quit (Read error: Connection reset by peer).
14:47:17 <esolangs> [[Snakel/Syntax]] https://esolangs.org/w/index.php?diff=149469&oldid=147797 * 47 * (+114)
14:48:11 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=149470&oldid=149468 * 47 * (-3) /* Python3 */
14:50:49 -!- amby has joined.
15:20:38 <esolangs> [[User:PrySigneToFry/Discussion]] https://esolangs.org/w/index.php?diff=149471&oldid=146627 * Tommyaweosmalt * (+317)
15:21:30 <esolangs> [[User:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=149472&oldid=143126 * Tommyaweosmalt * (+122)
15:28:36 <esolangs> [[User:PrySigneToFry/Discussion]] https://esolangs.org/w/index.php?diff=149473&oldid=149471 * ZCX islptng * (+648) /* */
15:30:32 <esolangs> [[User:PrySigneToFry/Discussion]] https://esolangs.org/w/index.php?diff=149474&oldid=149473 * ZCX islptng * (+112) /* */
16:41:15 -!- craigo has quit (Quit: Leaving).
16:59:41 <esolangs> [[Lack]] N https://esolangs.org/w/index.php?oldid=149475 * Dmiz * (+1572) Created page with "Lack is are an Esolang Based In Cells The Commands Are: {| class="wikitable" |+ |- ! Command !! Description |- | > || change the pointer by 1 |- | < || change the pointer by -1 |- | + || add 1 in pointer cell |- | - || subtract 1 in pointer cell |- | . || add ascii of poi
17:12:31 -!- DOS_User_webchat has joined.
17:21:07 <DOS_User_webchat> ok seems like all of irc is dead today (even the usually active channels)
17:21:20 -!- DOS_User_webchat has quit (Remote host closed the connection).
17:22:48 -!- ais523 has joined.
17:22:53 -!- lisbeths has quit (Quit: Connection closed for inactivity).
17:47:15 <esolangs> [[User:Win7HE]] https://esolangs.org/w/index.php?diff=149476&oldid=149286 * Win7HE * (+38) /* Eso (redirect) */
17:48:13 <esolangs> [[Hyperinotoidion]] https://esolangs.org/w/index.php?diff=149477&oldid=148204 * Win7HE * (+0)
17:48:58 <esolangs> [[Template talk:Stub]] https://esolangs.org/w/index.php?diff=149478&oldid=112080 * Win7HE * (+280)
18:05:34 <esolangs> [[Emmental/Printing Code That Prints Code]] N https://esolangs.org/w/index.php?oldid=149479 * Win7HE * (+4370) Created page with "its pretty large #35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#46.#35.#53.#54.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#49.#46.#35.#53.#51.#46.#35.#52.#54.#46.#35.#51.#53.#46.#35.#53.#50.#
18:06:05 <esolangs> [[Emmental/Printing Code That Prints Code]] https://esolangs.org/w/index.php?diff=149480&oldid=149479 * Win7HE * (+13)
18:12:37 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149481&oldid=149475 * Dmiz * (+323)
18:12:57 <esolangs> [[Branjunk]] https://esolangs.org/w/index.php?diff=149482&oldid=138857 * Win7HE * (-2) code stuff and stuff like grammar
18:15:42 <esolangs> [[Tommyaweosme unary]] https://esolangs.org/w/index.php?diff=149483&oldid=137203 * Win7HE * (+113)
18:16:24 <esolangs> [[Tommyaweosme unary]] https://esolangs.org/w/index.php?diff=149484&oldid=149483 * Win7HE * (+80)
18:18:20 <esolangs> [[Talk:Branjunk]] N https://esolangs.org/w/index.php?oldid=149485 * Win7HE * (+106) Created page with "i decided to make changes --~~~~"
18:20:51 <esolangs> [[User talk:Tommyaweosme]] https://esolangs.org/w/index.php?diff=149486&oldid=148829 * Win7HE * (+90)
18:24:26 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:25:18 <esolangs> [[User:Win7HE/random]] N https://esolangs.org/w/index.php?oldid=149487 * Win7HE * (+56) Created page with "<div style="transform:rotate(1deg)"> {{:Special:Random}}"
18:26:05 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149488&oldid=149487 * Win7HE * (+19)
18:28:44 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149489&oldid=149488 * Win7HE * (+32)
18:29:35 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149490&oldid=149489 * Win7HE * (-1)
18:30:45 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:31:51 -!- Lord_of_Life has joined.
18:34:00 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149491&oldid=149490 * Win7HE * (+96)
18:35:23 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149492&oldid=149491 * Win7HE * (+20)
18:36:23 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149493&oldid=149492 * Win7HE * (-80)
18:37:48 <esolangs> [[User:Win7HE/random]] https://esolangs.org/w/index.php?diff=149494&oldid=149493 * Win7HE * (+30)
18:49:57 -!- tromp has joined.
18:54:00 <esolangs> [[User:Dmiz]] https://esolangs.org/w/index.php?diff=149495&oldid=149187 * Dmiz * (+59)
18:58:07 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149496&oldid=149481 * Dmiz * (-1)
19:10:23 <esolangs> [[Special:Log/newusers]] create * Placeholding * New user account
19:11:28 -!- ais523 has quit (Ping timeout: 265 seconds).
19:30:01 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149497&oldid=149389 * Placeholding * (+435)
19:43:05 -!- Sgeo has joined.
19:55:20 <esolangs> [[User:Placeholding]] N https://esolangs.org/w/index.php?oldid=149498 * Placeholding * (+67) Created page with "hello. welcome to my user page.<br> i have nothing else to say here"
20:07:29 -!- Sgeo has quit (Read error: Connection reset by peer).
20:10:51 -!- Sgeo has joined.
20:28:52 <esolangs> [[This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it]] M https://esolangs.org/w/index.php?diff=149499&oldid=120450 * TheCanon2 * (+18) category
20:33:24 -!- DOS_User_webchat has joined.
20:33:35 -!- DOS_User_webchat has quit (Remote host closed the connection).
20:51:30 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:53:18 -!- Everything has joined.
20:57:04 -!- tromp has joined.
20:59:09 -!- ais523 has joined.
21:14:46 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149500&oldid=149452 * Jan jelo * (+161) /* Muriel */
21:16:09 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=149501&oldid=149228 * Jan jelo * (+168) /* Examples */
21:38:25 -!- Sgeo has quit (Read error: Connection reset by peer).
21:41:29 -!- Sgeo has joined.
22:19:39 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:22:56 -!- tromp has joined.
22:37:05 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:48:48 -!- Everything has quit (Quit: leaving).
22:51:09 -!- DOS_User_webchat has joined.
23:31:12 -!- chiselfuse has quit (Remote host closed the connection).
23:31:15 -!- DOS_User_webchat has quit (Remote host closed the connection).
23:31:25 -!- chiselfuse has joined.
00:03:46 -!- mtm has quit (Ping timeout: 252 seconds).
00:05:24 -!- mtm has joined.
00:06:21 -!- chiselfu1e has joined.
00:08:36 -!- chiselfuse has quit (Ping timeout: 264 seconds).
00:23:59 -!- __monty__ has quit (Quit: leaving).
00:37:21 <esolangs> [[This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it]] M https://esolangs.org/w/index.php?diff=149502&oldid=149499 * PkmnQ * (+4)
01:45:06 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149503&oldid=149450 * ZCX islptng * (+924)
02:06:22 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149504&oldid=149503 * ZCX islptng * (+15)
02:12:40 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149505&oldid=149504 * ZCX islptng * (+105)
02:31:33 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149506&oldid=149505 * ZCX islptng * (+438)
02:41:33 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149507&oldid=149506 * ZCX islptng * (+15)
02:45:47 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149508&oldid=149507 * ZCX islptng * (+1140)
02:50:59 <esolangs> [[User talk:ZCX islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149509&oldid=149508 * ZCX islptng * (+223)
03:03:53 -!- amby has quit (Remote host closed the connection).
03:06:45 <esolangs> [[Special:Log/move]] move * ZCX islptng * moved [[SLet]] to [[SLet (Old 2)]]
03:06:58 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149512&oldid=149511 * ZCX islptng * (-26) Blanked the page
03:08:06 <esolangs> [[User:ZCX islptng]] https://esolangs.org/w/index.php?diff=149513&oldid=148680 * ZCX islptng * (-10)
03:09:22 <esolangs> [[SLet (Old 2)]] https://esolangs.org/w/index.php?diff=149514&oldid=149510 * ZCX islptng * (-73)
03:10:30 <esolangs> [[SLet (Old)]] https://esolangs.org/w/index.php?diff=149515&oldid=146586 * ZCX islptng * (+29)
03:12:35 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149516&oldid=149512 * ZCX islptng * (+156)
03:13:22 <esolangs> [[Uhidklol]] N https://esolangs.org/w/index.php?oldid=149517 * Juanp32 * (+2636) make this page now that ive named it
03:13:38 <esolangs> [[SLet/Implementation]] https://esolangs.org/w/index.php?diff=149518&oldid=149197 * ZCX islptng * (+10801) Undo revision [[Special:Diff/149197|149197]] by [[Special:Contributions/ZCX islptng|ZCX islptng]] ([[User talk:ZCX islptng|talk]])
03:13:54 <esolangs> [[Special:Log/move]] move * ZCX islptng * moved [[SLet/Implementation]] to [[SLet (Old 2)/Implementation]]
03:14:05 <esolangs> [[SLet/Implementation]] https://esolangs.org/w/index.php?diff=149521&oldid=149520 * ZCX islptng * (-33) Removed redirect to [[SLet (Old 2)/Implementation]]
03:14:31 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149522&oldid=149459 * Juanp32 * (+15) /* U */
03:14:32 <esolangs> [[SLet (Old 2)]] https://esolangs.org/w/index.php?diff=149523&oldid=149514 * ZCX islptng * (-2)
03:21:05 <esolangs> [[User:Juanp32]] https://esolangs.org/w/index.php?diff=149524&oldid=149390 * Juanp32 * (+51)
03:22:47 <esolangs> [[Uhidklol]] M https://esolangs.org/w/index.php?diff=149525&oldid=149517 * Juanp32 * (+13) oooops had to fix a typo
03:34:29 <esolangs> [[Uhidklol]] M https://esolangs.org/w/index.php?diff=149526&oldid=149525 * Juanp32 * (+245) made the info a bit clearer, pluss added an entry to the list
03:35:04 <esolangs> [[Talk:ABPLWNL]] https://esolangs.org/w/index.php?diff=149527&oldid=132149 * BestCoder * (+371) /* actually you can "loop" forever unconditionally */ new section
03:49:00 -!- ais523 has quit (Ping timeout: 252 seconds).
05:11:22 <zemhill> web.Optinyuroki: points 15.50, score 40.24, rank 3/47 (+1)
05:25:46 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149528&oldid=149516 * ZCX islptng * (+1456)
05:36:44 <esolangs> [[BF Lite]] https://esolangs.org/w/index.php?diff=149529&oldid=120288 * BestCoder * (+27)
05:37:04 <esolangs> [[Category:MistakeInSpec]] N https://esolangs.org/w/index.php?oldid=149530 * BestCoder * (+35) Created page with "when you make a mistake in the spec"
05:50:29 <esolangs> [[Talk:Autism]] N https://esolangs.org/w/index.php?oldid=149531 * BestCoder * (+81) Created page with "I feel kinda offended ~~~"
06:04:44 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149532&oldid=149528 * ZCX islptng * (+976)
06:14:34 <esolangs> [[Talk:Asd]] N https://esolangs.org/w/index.php?oldid=149533 * BestCoder * (+41) Created page with "doesnt that mean autism spectrum disorder"
06:15:03 <esolangs> [[Esolang testing]] N https://esolangs.org/w/index.php?oldid=149534 * BestCoder * (+1) Created page with "e"
06:15:13 <esolangs> [[Talk:Esolang testing]] N https://esolangs.org/w/index.php?oldid=149535 * BestCoder * (+623) Created page with "--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~--~~~~"
06:56:02 -!- Sgeo has quit (Read error: Connection reset by peer).
07:21:34 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149536&oldid=149532 * ZCX islptng * (+34)
08:32:28 -!- FreeFull has quit (Remote host closed the connection).
08:37:44 -!- tromp has joined.
08:38:09 -!- b_jonas has quit (Ping timeout: 265 seconds).
08:39:52 -!- b_jonas has joined.
09:24:12 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149537&oldid=149456 * None1 * (-2) /* Dialects created in 2025 */
09:26:35 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149538&oldid=149537 * None1 * (+142) /* Example Programs */ Add examples
09:27:54 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149539&oldid=149538 * None1 * (+113) /* Type 13 */
09:29:24 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149540&oldid=149539 * None1 * (+122) /* Type 13 */
09:29:45 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149541&oldid=149540 * None1 * (-19) /* type 11/Nil/APLWSI interpreter */
09:30:35 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149542&oldid=149541 * None1 * (+170) /* Interpreters */
09:31:13 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149543&oldid=149542 * None1 * (+27)
09:44:43 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149544&oldid=149500 * None1 * (+24) /* Type 1 and Type 2 and Type 6 and Type 7 and Type 9 and Type 10 */
09:46:06 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149545&oldid=149544 * None1 * (+12) /* Type 3 and Type 5 and Type 8 */
09:55:01 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:15:11 <esolangs> [[Void]] N https://esolangs.org/w/index.php?oldid=149546 * None1 * (+2167) Created page with "'''Void''' is [[User:None1]]'s first esolang (that isn't a dialect of an old esolang) invented in 2025. ==Types== This esolang is an untyped one as it has only 1 type: '''void'''. Unlike the type with the same name in most practical languages, this type can not only store em
10:15:40 <esolangs> [[Void]] https://esolangs.org/w/index.php?diff=149547&oldid=149546 * None1 * (+4)
10:17:09 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149548&oldid=149522 * None1 * (+11) /* V */
10:18:35 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=149549&oldid=148986 * None1 * (+57) /* My Esolangs */
10:27:53 -!- DOS_User_webchat has joined.
10:37:00 -!- DOS_User_webchat has quit (Remote host closed the connection).
10:39:20 -!- DOS_User_webchat has joined.
10:41:00 -!- DOS_User_webchat has quit (Remote host closed the connection).
10:48:47 -!- tromp has joined.
11:00:48 -!- __monty__ has joined.
11:45:50 <isabella> how do people typically combine macros in a language like lambda calculus?
11:46:37 <isabella> i have a language that has variables and named macros
11:47:01 <isabella> they're not functions so i don't have proper scoping for variables
11:47:45 <isabella> how do i do something like f(f(a,b), f(c,d)) without them stepping on each other's toes?
12:04:30 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:12 -!- mtm has joined.
12:09:25 <FireFly> I don't think you can, if you mean that the "call" f(a,b) and the one for f(c,d) clobber the same variables
12:10:07 <FireFly> or well hm, I guess if you transform it to a form where everything is done serially? foo = f(a,b); bar = f(c,d); baz = f(foo, bar); and generate uniue names for each intermediate stage
12:13:08 -!- FreeFull has joined.
12:20:37 -!- ais523 has joined.
12:21:19 <ais523> isabella: I think you may be looking for "hygienic macros", see https://en.wikipedia.org/wiki/Hygienic_macro
12:23:50 <isabella> i think i'm going to go with a stack
13:08:07 <esolangs> [[Special:Log/newusers]] create * RedstoneMedia * New user account
13:09:49 <esolangs> [[User:Jan jelo/ASK calculus interpreter]] N https://esolangs.org/w/index.php?oldid=149550 * Jan jelo * (+1701) Created page with "This is a stack-based [[Ask-calculus]] interpreter in Python by [[User:Jan jelo]]. <pre> def pop(x,l): a=l.pop() x.append(a) if a==')': i=1 while i: a=l[-1] x.append(l.pop()) if a=='(':i-=1 if a==')':i+=1 return y=[];
13:12:56 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
13:12:56 <zemhill> ais523.two_thirds: points 15.90, score 42.60, rank 3/47 (+1)
13:15:16 <esolangs> [[User:Jan jelo/ASK calculus interpreter]] M https://esolangs.org/w/index.php?diff=149551&oldid=149550 * Jan jelo * (+35)
13:16:08 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149552&oldid=149430 * Jan jelo * (+44) /* Intepreters */
13:17:34 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
13:17:34 <zemhill> ais523.two_thirds: points 16.10, score 42.96, rank 3/47 (--)
13:29:55 <esolangs> [[Void]] https://esolangs.org/w/index.php?diff=149553&oldid=149547 * None1 * (+2) /* =Named functions */
13:30:25 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
13:30:25 <zemhill> ais523.two_thirds: points 16.26, score 43.38, rank 2/47 (+1)
13:37:31 -!- amby has joined.
13:48:11 <esolangs> [[User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=149554&oldid=149451 * None1 * (+557) /* To get code-golfing, I recommend to use the Base-100. */
14:15:41 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
14:15:41 <zemhill> ais523.two_thirds: points 17.88, score 47.69, rank 2/47 (--)
14:23:40 <esolangs> [[Special:Log/move]] move * Jan jelo * moved [[User:Jan jelo/ASK calculus interpreter]] to [[User:Jan jelo/SKA calculus interpreter]]
14:24:12 <esolangs> [[User:Jan jelo/SKA calculus interpreter]] https://esolangs.org/w/index.php?diff=149557&oldid=149555 * Jan jelo * (+13)
14:28:21 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] N https://esolangs.org/w/index.php?oldid=149558 * Juanp32 * (+3854) im bored and randomly got this idea
14:30:02 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149559&oldid=149548 * Juanp32 * (+78) /* Non-alphabetic */
14:30:18 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149560&oldid=149552 * Jan jelo * (+0) /* Intepreters */
14:33:16 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] https://esolangs.org/w/index.php?diff=149561&oldid=149558 * Juanp32 * (+195) please tell me in what list this should go in the talk page
14:34:27 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] M https://esolangs.org/w/index.php?diff=149562&oldid=149561 * Juanp32 * (+6) oooops formatting
14:35:40 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] M https://esolangs.org/w/index.php?diff=149563&oldid=149562 * Juanp32 * (+18) DANGIT ACCIDENTALLY CLICKED SAVE INSTEAD OF PREVIEW lets assume both header and list edits were the same edit k?
14:38:53 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] M https://esolangs.org/w/index.php?diff=149564&oldid=149563 * Juanp32 * (+0) this is it im not editing on mobile ever again. fat fingers i keep misclicking >:/
14:45:44 -!- DOS_User_webchat has joined.
14:53:01 <esolangs> [[IRC]] M https://esolangs.org/w/index.php?diff=149565&oldid=85668 * Juanp32 * (+0) /* Reserved words */ typo, said "voided" instead of "voiced"
14:57:35 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
14:57:35 <zemhill> ais523.two_thirds: points 18.93, score 50.35, rank 2/47 (--)
15:00:48 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=149566&oldid=149536 * ZCX islptng * (+100)
15:03:55 -!- Sgeo has joined.
15:17:46 -!- DOS_User_webchat has quit (Remote host closed the connection).
15:43:59 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
15:51:44 -!- tromp has joined.
15:56:47 -!- molson__ has joined.
15:57:52 <esolangs> [[BF Joust strategies]] https://esolangs.org/w/index.php?diff=149567&oldid=149115 * Ais523 * (+2068) /* Cleared decoy detection */ a few of my programs have done this now and it seems pretty helpful in general in fact, there are enough programs doing this to provide a metagame of countermeasures, and countermeasures to the countermeasures
15:58:04 <esolangs> [[Talk:This esoteric programming language has one of the longest titles, and yet it only has one command, which is such a shame, but there is no way to undo it so we may as well stick with it]] N https://esolangs.org/w/index.php?oldid=149568 * Aadenboy * (+362) Created page with "184 characters for an among us joke,, truly the demise of the british empire ~~~~"
15:59:46 -!- molson_ has quit (Ping timeout: 248 seconds).
16:13:17 <ais523> hmm, two_thirds now ties with one program but beats all the rest, but nonetheless isn't in first place because many of the wins are very narrow
16:14:02 <ais523> I think that's probably correct; in a sense, backstop2 is "more impressive" because it beats most programs by large margins
16:17:47 -!- molson__ has quit (Quit: Leaving).
16:21:09 -!- molson has joined.
16:41:36 -!- molson has quit (Remote host closed the connection).
16:42:04 -!- molson has joined.
17:18:30 <isabella> https://gist.github.com/izabera/8c541886c3992d328255944bc3de62c7 the thing from a few hours ago
17:32:13 -!- ais523 has quit (Ping timeout: 244 seconds).
17:45:57 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:53:55 -!- tromp has joined.
17:58:04 -!- ais523 has joined.
18:18:53 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149569&oldid=149496 * Dmiz * (+135)
18:26:19 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149570&oldid=149569 * Dmiz * (+86)
18:32:02 -!- Lord_of_Life_ has joined.
18:33:30 -!- Lord_of_Life has quit (Ping timeout: 272 seconds).
18:35:01 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:40:40 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149571&oldid=149570 * Dmiz * (-10)
19:14:22 -!- ais523 has quit (Quit: quit).
19:32:34 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149572&oldid=149497 * Buckets * (+327)
19:33:27 <esolangs> [[Javagrid]] M https://esolangs.org/w/index.php?diff=149573&oldid=65225 * Buckets * (+1)
19:38:23 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:54:11 -!- tromp has joined.
19:56:39 <esolangs> [[ETA]] https://esolangs.org/w/index.php?diff=149574&oldid=106485 * Buckets * (+120)
20:09:21 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:13:49 <esolangs> [[W)]] M https://esolangs.org/w/index.php?diff=149575&oldid=141114 * Buckets * (+2)
20:21:57 <korvo> isabella: Delightful, thanks for sharing.
20:25:31 -!- tromp has joined.
20:29:57 -!- __monty__ has quit (Ping timeout: 244 seconds).
20:30:39 -!- molson has quit (Ping timeout: 260 seconds).
20:39:52 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:44:00 <esolangs> [[User:Jan jelo/JSFuck code generator]] N https://esolangs.org/w/index.php?oldid=149576 * Jan jelo * (+1901) Created page with "This is a [[JSFuck]] code generator in python by [[User:Jan jelo]]. <pre> false='(![])' true=f'!{false}' _0=f'(+[])' _1=f'(+{true})' succ=lambda x:f'({x}+{_1})' _2=succ(_1) _3=succ(_2) _4=f'({_2}+{_2})' _5=f'({_2}+{_3})' _6=f'({_3}+{_3})' _7
20:45:46 <esolangs> [[User:Jan jelo/JSFuck code generator]] M https://esolangs.org/w/index.php?diff=149577&oldid=149576 * Jan jelo * (+10)
20:50:27 <esolangs> [[User:Jan jelo/JSFuck code generator]] M https://esolangs.org/w/index.php?diff=149578&oldid=149577 * Jan jelo * (+27)
20:51:42 <esolangs> [[User:Jan jelo]] M https://esolangs.org/w/index.php?diff=149579&oldid=149560 * Jan jelo * (+0) typo
20:55:59 -!- tromp has joined.
20:57:40 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149580&oldid=149579 * Jan jelo * (+41) /* Code generators */
21:04:43 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=149581&oldid=149437 * Jan jelo * (+22) /* Python (Python 3) */
21:06:18 <esolangs> [[User:Jan jelo/a quine in python that contains a underload interpreter]] N https://esolangs.org/w/index.php?oldid=149582 * Jan jelo * (+2407) Created page with "This is a [[Quine]] program in python by [[User:Jan jelo]]. It contains a [[Underload]] interpreter. <pre> def run(p): stack=[] program=p while program: x,program=program[0],program[1:]
21:07:42 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=149583&oldid=149580 * Jan jelo * (+87)
21:12:19 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149584&oldid=149465 * Ractangle * (-6) /* Stuff to continue */
21:13:07 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149585&oldid=149584 * Ractangle * (-8) /* Stuff to continue */
21:16:51 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:16:52 <esolangs> [[User:Jan jelo/JSFuck code generator]] M https://esolangs.org/w/index.php?diff=149586&oldid=149578 * Jan jelo * (-16)
21:17:28 <esolangs> [[User:Jan jelo/JSFuck code generator]] M https://esolangs.org/w/index.php?diff=149587&oldid=149586 * Jan jelo * (-1)
21:17:57 <esolangs> [[Special:Log/move]] move * Ractangle * moved [[ITECAAPL]] to [[Marb]]
21:18:49 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149590&oldid=149588 * Ractangle * (-104) finishing this later
21:42:11 <esolangs> [[User:Jan jelo/SKA calculus interpreter]] https://esolangs.org/w/index.php?diff=149591&oldid=149557 * Jan jelo * (+193)
21:46:00 -!- molson has joined.
21:46:36 -!- tromp has joined.
21:47:33 -!- tromp has quit (Client Quit).
21:48:57 -!- tromp has joined.
22:18:01 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:18:35 -!- DOS_User_webchat has joined.
22:19:39 -!- tromp has joined.
22:27:47 -!- DOS_User_webchat has quit (Remote host closed the connection).
22:28:03 -!- DOS_User_webchat has joined.
22:37:26 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:44:08 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149592&oldid=148332 * Juanp32 * (+171)
22:47:48 -!- DOS_User_webchat has quit (Remote host closed the connection).
23:35:28 <esolangs> [[User:Juanp32]] https://esolangs.org/w/index.php?diff=149593&oldid=149524 * Juanp32 * (+149) since i made 2 languages i guess its time to make a list amirite
00:04:04 -!- mtm has quit (Ping timeout: 244 seconds).
00:05:32 -!- mtm has joined.
00:33:06 -!- craigo has joined.
00:34:33 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=149594&oldid=149571 * Dmiz * (+63)
00:41:25 -!- chiselfu1e has changed nick to chiselfuse.
01:30:05 <zemhill> web.Optinyuroki: points 16.57, score 42.00, rank 3/47 (+1)
02:10:48 -!- Bowserinator has joined.
02:10:56 -!- Bowserinator_ has quit (Read error: Connection reset by peer).
02:25:41 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:54:57 -!- ming has joined.
03:09:08 -!- molson_ has joined.
03:10:13 -!- ming has quit (Ping timeout: 248 seconds).
03:11:34 -!- molson has quit (Ping timeout: 260 seconds).
03:17:04 -!- yewscion has joined.
04:40:12 -!- yewscion has quit (Ping timeout: 246 seconds).
04:42:06 -!- yewscion has joined.
04:45:20 -!- yewscion has quit (Read error: Connection reset by peer).
04:45:28 -!- yewscion_ has joined.
04:48:08 -!- yewscion_ has quit (Max SendQ exceeded).
04:49:24 -!- yewscion has joined.
06:15:49 -!- yewscion has quit (Ping timeout: 248 seconds).
07:18:59 -!- Sgeo has quit (Read error: Connection reset by peer).
07:31:30 -!- tromp has joined.
07:41:34 <esolangs> [[Special:Log/newusers]] create * I am islptng * New user account
07:42:12 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149595&oldid=149572 * I am islptng * (+146)
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng]] to [[User:I am islptng]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/List of "x bits, y bytes"]] to [[User:I am islptng/List of "x bits, y bytes"]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/My rate to the user I know]] to [[User:I am islptng/My rate to the user I know]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/Redirect]] to [[User:I am islptng/Redirect]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/Sandbox]] to [[User:I am islptng/Sandbox]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/TCP1]] to [[User:I am islptng/TCP1]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User:ZCX islptng/Template:Signature]] to [[User:I am islptng/Template:Signature]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User talk:ZCX islptng]] to [[User talk:I am islptng]]
07:43:29 <esolangs> [[Special:Log/move]] move * I am islptng * moved [[User talk:ZCX islptng/Sandbox]] to [[User talk:I am islptng/Sandbox]]
07:44:44 <esolangs> [[Template:User:ZCX islptng/Signature]] https://esolangs.org/w/index.php?diff=149614&oldid=147102 * I am islptng * (-476) Blanked the page
07:51:06 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149615&oldid=148156 * I am islptng * (+592) /* Please ban User:ZCX islptng. */ new section
08:04:07 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=149616&oldid=149596 * I am islptng * (+223)
08:04:53 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=149617&oldid=149616 * I am islptng * (+4)
08:14:34 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=149618&oldid=149617 * I am islptng * (+73)
08:20:28 <esolangs> [[User:I am islptng/List of the users that is also in conwaylife.com]] N https://esolangs.org/w/index.php?oldid=149619 * I am islptng * (+429) Created page with "I welcome everybody that is both on conwaylife.com and esolangs.org to edit it!<br> Incomplete list {|class=wikitable ! Esolangs.org name !! LifeWiki name !! ConwayLife Forums name !! How |- | I am islptng
08:58:18 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149620&oldid=149590 * 47 * (+77)
09:15:39 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:39:16 -!- __monty__ has joined.
10:18:52 -!- m5zs7k has quit (Ping timeout: 252 seconds).
10:25:13 -!- m5zs7k has joined.
10:34:09 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149621&oldid=149620 * 47 * (+87)
10:52:14 -!- tromp has joined.
11:43:46 <esolangs> [[!@$%^&*()+=]] https://esolangs.org/w/index.php?diff=149622&oldid=148771 * Xyzzy * (+12)
11:46:48 <esolangs> [[User:Xyzzy/Sandbox]] N https://esolangs.org/w/index.php?oldid=149623 * Xyzzy * (+3) Created page with "idk"
12:02:32 -!- mtm has quit (Ping timeout: 244 seconds).
12:06:17 -!- mtm has joined.
12:16:46 <esolangs> [[6]] https://esolangs.org/w/index.php?diff=149624&oldid=145396 * 47 * (-73) /* Online interpreters */
12:32:54 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CM Truthmachine.png]]": Truth Machine for ChromaCode
12:37:07 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CM Catstr.png]]": String Cat Program for ChromaCode
12:38:00 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CM Catnum.png]]": Number Cat Program for ChromaCode
12:39:28 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CM Xkcd221.png]]": XKCD RNG for ChromaCode
12:41:49 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CM Fibonacci.png]]"
12:42:26 <esolangs> [[@everyone but they had to move to irc bcuz they got banned from discord]] https://esolangs.org/w/index.php?diff=149630&oldid=149564 * 47 * (+41) /* errors */
12:45:21 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CC Factorial.png]]"
12:47:15 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CC Listevennumbers.png]]"
12:48:26 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CC Iseven.png]]"
12:49:55 <esolangs> [[Special:Log/upload]] upload * QuantumV * uploaded "[[File:CC Hi.png]]"
13:00:01 <esolangs> [[ChromaCode]] N https://esolangs.org/w/index.php?oldid=149635 * QuantumV * (+3317) Create page
13:02:31 <esolangs> [[ChromaCode]] M https://esolangs.org/w/index.php?diff=149636&oldid=149635 * QuantumV * (-6)
13:03:55 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149637&oldid=149559 * QuantumV * (+18) add chromacode
13:04:23 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=149638&oldid=149637 * QuantumV * (-1)
13:11:46 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=149639&oldid=148642 * QuantumV * (+80) add chromacode
13:12:46 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149640&oldid=149545 * QuantumV * (+89) add chromacode
13:16:35 <esolangs> [[ChromaCode]] https://esolangs.org/w/index.php?diff=149641&oldid=149636 * QuantumV * (+213) better description
14:13:13 -!- amby has joined.
14:29:30 <esolangs> [[fuck]] https://esolangs.org/w/index.php?diff=149642&oldid=133904 * None1 * (-1) /* Induct */
14:37:43 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149643&oldid=149378 * None1 * (+151) /* Cat program */
14:38:50 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149644&oldid=149643 * None1 * (+4) /* Overview */
14:45:34 <esolangs> [[TMMLPTEALPAITAFNFAL]] https://esolangs.org/w/index.php?diff=149645&oldid=110906 * Win7HE * (+11) /* External resources */
14:49:35 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149646&oldid=149621 * Ractangle * (+484)
14:52:30 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149647&oldid=149646 * Ractangle * (+37) /* Syntax */
15:40:38 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
15:42:25 <HackEso> olist <https://www.giantitp.com/comics/oots1316.html>: shachaf oerjan Sgeo boily nortti b_jonas Noisytoot
15:49:40 -!- craigo has quit (Ping timeout: 252 seconds).
15:59:22 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149648&oldid=147453 * Win7HE * (+138) /* Original Command */
15:59:51 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149649&oldid=149648 * Win7HE * (-138) /* Original Command */
16:00:59 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149650&oldid=149649 * Win7HE * (+176) /* Additions */
16:01:33 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149651&oldid=149650 * Win7HE * (+3) /* 99 bottles of beers */
16:03:33 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149652&oldid=149651 * Win7HE * (+18)
16:04:43 -!- tromp has joined.
16:05:02 <esolangs> [[Talk:Dir]] N https://esolangs.org/w/index.php?oldid=149653 * Juanp32 * (+275) bro. if you dont put any info on an esolang besides "i made this" then dont make the page at all. it makes no sense. at least write some basic documentation in the page
16:09:35 <esolangs> [[Talk:2025!]] N https://esolangs.org/w/index.php?oldid=149654 * Win7HE * (+117) Created page with "swhrenndid you create this esyoolang --~~~~"
16:11:29 -!- ais523 has joined.
16:12:21 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
16:12:22 <zemhill> ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--)
16:13:10 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
16:13:10 <zemhill> ais523.two_thirds: points 18.76, score 49.99, rank 2/47 (--)
16:13:27 <ais523> now beats every other program but is still in second place :-)
16:15:29 <zemhill> ais523.backstop2: points -46.00, score 0.00, rank 47/47 (-46)
16:15:46 <ais523> !zjoust backstop2 http://nethack4.org/pastebin/backstop2.bfjoust
16:15:47 <zemhill> ais523.backstop2: points 22.62, score 61.20, rank 1/47 (+46)
16:16:33 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149655&oldid=149280 * Calculus is fun * (+778) Added more examples related to repeat.
16:21:08 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149656&oldid=149655 * Calculus is fun * (-2) word change
16:23:29 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149657&oldid=149615 * Ais523 * (+280) /* Please ban User:ZCX islptng. */ that doesn't need a ban
16:30:38 <int-e> "ntroduction to Prolog: A Programming Language for AI"
16:31:33 <int-e> https://prologyear.logicprogramming.org/ may be a factor too
16:33:43 <myname> i mean, that kinda was the case back when "ai" wasn27
16:33:53 <myname> wasnt a buzzword for gpt
16:34:15 <int-e> or neural networks
16:34:46 <int-e> I associate this with early AI efforts... expert systems.
16:34:57 <myname> but for querying knowledge databases in prolog is great
16:35:08 <myname> i would love for curry to be more mainstream, though
16:35:14 <int-e> but that article is from 2022 ;)
16:35:38 <int-e> Or 2023. Link: https://builtin.com/software-engineering-perspectives/prolog
16:35:52 <myname> thats kinda late to the party
16:37:24 <int-e> Oh it has an "Example AI Application of Prolog"
16:38:53 <myname> incredible artificial intelligence at work
16:38:54 <int-e> (yes, medical diagnoses are all black or white and Prolog is the perfect tool for *achoo* that)
16:44:17 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=149658&oldid=149099 * Ais523 * (+3990) /* 2025 */ add ais523.two_thirds
16:45:07 <esolangs> [[BF Joust champions]] M https://esolangs.org/w/index.php?diff=149659&oldid=149658 * Ais523 * (-1) /* 2025 */ grammar
16:49:42 <ais523> !zjoust two_thirds http://nethack4.org/pastebin/two_thirds.bfjoust
16:49:43 <zemhill> ais523.two_thirds: points 18.83, score 50.17, rank 2/47 (--)
16:50:19 <myname> i recently learned about lean and i am somewhat excited about that
16:52:41 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=149660&oldid=149659 * Ais523 * (+106) /* 2025 */ mention the 3-cycle clear; also fix the explanation of the fast rush (the program was buggy and was also fixed to match the explanation, improving its score slightly)
16:53:32 <esolangs> [[Talk:2025!]] https://esolangs.org/w/index.php?diff=149661&oldid=149654 * Aadenboy * (+384)
16:55:19 <esolangs> [[!@$%^&*()+]] M https://esolangs.org/w/index.php?diff=149662&oldid=144952 * Aadenboy * (-1)
16:57:17 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=149663&oldid=149660 * Ais523 * (+449) /* 2025 */ mention the trail innovation
16:57:56 <int-e> What a great hotkey you picked there, Twitch... alt-T would never do anything in a browser. (Firefox has a _T_ools menu)
17:28:52 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149664&oldid=149595 * Galvandi * (+391) /* Introductions */
17:32:12 <esolangs> [[User:Galvandi/Sandbox]] N https://esolangs.org/w/index.php?oldid=149665 * Galvandi * (+4) Created page with "Test"
18:01:15 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:07:32 <FireFly> int-e: see that's your mistake, yer supposed to use a dedicated browser for it (well, in the form of electron)
18:08:06 <int-e> electron, my arch-nemesis
18:08:52 <int-e> (unrelated... but there's so many games that use electron but only provide windows and macos executables and wine chokes on electron apps)
18:09:32 <int-e> (the irony of electron being supposedly portable is not lost on me)
18:16:18 -!- tromp has joined.
18:24:50 -!- ais523 has quit (Ping timeout: 272 seconds).
18:27:29 <FireFly> I wonder how hard it would be to write something to "convert" such an executable to something that can be readily run.. I guess the tricky part would be dependencies on dll's and similar
18:32:38 -!- Lord_of_Life_ has joined.
18:33:34 -!- Lord_of_Life has quit (Ping timeout: 252 seconds).
18:35:34 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:35:53 <esolangs> [[Special:Log/upload]] upload * Galvandi * uploaded "[[File:Dominoscript-logo.png]]"
18:39:32 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=149667&oldid=149639 * Jan jelo * (+197) /* Implementations */
18:40:31 <esolangs> [[Recs]] https://esolangs.org/w/index.php?diff=149668&oldid=148410 * Jan jelo * (+3) /* Example */
19:06:10 <zzo38> I think there are better ways to make portable programs anyways
19:06:22 <zzo38> (Although, it also depends on what you expect the program to do)
19:10:05 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=149669&oldid=148686 * Jan jelo * (+149) /* Example programs */
19:11:27 -!- ais523 has joined.
19:15:39 <esolangs> [[Special:Log/upload]] upload * Galvandi * uploaded "[[File:DominoScript noop code visual representation .png]]"
19:19:33 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=149671&oldid=149669 * Jan jelo * (-6) /* Example programs */
19:27:50 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149672&oldid=149647 * 47 * (+39) /* Implementation */
19:43:03 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149673&oldid=149672 * 47 * (+19) /* Syntax */
19:48:41 -!- chiselfuse has quit (Read error: Connection reset by peer).
19:48:56 -!- chiselfuse has joined.
20:04:28 <esolangs> [[User:RocketRace]] https://esolangs.org/w/index.php?diff=149674&oldid=148585 * RocketRace * (-52)
20:09:49 <esolangs> [[Special:Log/upload]] upload * Galvandi * uploaded "[[File:DominoScript-Example-003-flow.png]]"
21:27:26 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:36:54 -!- tromp has joined.
21:47:23 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149676&oldid=149585 * Ractangle * (-14) /* Stuff to continue */
21:48:24 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=149677&oldid=149337 * Ractangle * (+24) /* Esolangs */
21:49:44 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149678&oldid=149673 * Ractangle * (+52) /* Examples */
21:52:29 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149679&oldid=149640 * Ractangle * (+43) /* Malbolge Unshackled */
21:57:59 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:26:36 -!- chiselfuse has quit (Ping timeout: 264 seconds).
22:27:14 -!- chiselfuse has joined.
22:38:39 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149680&oldid=149656 * Calculus is fun * (+308) Restructuring
22:58:54 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149681&oldid=149652 * Juanp32 * (+287) /* Additions */
23:02:23 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=149682&oldid=149681 * Juanp32 * (+53) /* Programs */
23:03:22 <esolangs> [[Free Esolang]] M https://esolangs.org/w/index.php?diff=149683&oldid=149682 * Juanp32 * (+13) ooooops forgot a <code> tag
23:33:11 -!- __monty__ has quit (Quit: leaving).
23:41:03 -!- Sgeo has joined.
00:02:27 -!- mtm has quit (Ping timeout: 252 seconds).
00:05:03 -!- mtm has joined.
00:53:57 <esolangs> [[Kolakoski sequence]] N https://esolangs.org/w/index.php?oldid=149684 * PkmnQ * (+1103) Created page with "The [[Kolakoski sequence]] is a sequence of 1's and 2's such that if you take the lengths of each run of the sequence, the result is the same as the original sequence. There are actually two sequences that fit this definition with their only difference being a
01:42:22 <esolangs> [[Tiny]] M https://esolangs.org/w/index.php?diff=149685&oldid=108815 * Ron.hudson * (+63) Add github page
01:57:06 <int-e> @oeis 1,2,4,8,16,31
01:57:19 * int-e wonders how long *that* has been broken
01:58:16 <int-e> (for a stupid reason too; http://oeis.org/search forcefully redirects to HTTPS)
02:14:33 <int-e> Yeah I know that one broke too.
02:22:18 <int-e> Wow that API endpoint is completely different now.
02:22:37 <int-e> And also does the mandatory HTTPS thing which is annoying.
02:36:10 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:44:44 <zzo38> Unfortunately many servers have mandatory HTTPS and I think that they shouldn't do that (but they won't believe me, I think).
02:45:09 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNumerals.png]]": numerals zero through nine
02:45:28 <zzo38> (Gemini protocol has only TLS, and some others that some people had make up also decide the same thing, even though I think that is no good. I wrote Scorpion protocol to specify that a server is not supposed to have mandatory TLS (except files that require a client certificate to access).)
02:46:23 <korvo> Hm. So, sorry if I'm repeating myself. (Brain damage is a literary device, etc.) There are several standard problems on the wiki which are well-known enough to serve as general-purpose comparison points: truth machine, quine, etc. Do we have an embarassingly-parallel problem?
02:46:59 <zzo38> I don't know, but perhaps they should have
02:47:23 <korvo> The idea would be to hack out something like a Mandelbrot set to show off parallelism in a language or toolkit. Mandelbrot might not be the best because it's graphical, chaotic, and possibly too expensive.
02:48:05 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaNumerals.png]]": padding fix
03:39:33 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNop.png]]": small square
03:40:07 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaInput.png]]": downward half-barbed arrow
03:40:26 <esolangs> [[User:Aadenboy/Draft]] N https://esolangs.org/w/index.php?oldid=149690 * Aadenboy * (+2533) [[Kawa]] draft
03:42:59 <ais523> korvo: FizzBuzz is almost embarassingly parallel, apart from the I/O
03:43:23 <ais523> but in general I'd expect such programs to parallelize well only by chance as the people who create them probably have single-threaded imperative languages in mind
03:44:36 <korvo> ais523: That's not terrible, although yeah, the I/O's kind of important since it has to be serialized correctly.
03:46:07 <korvo> Concretely, suppose I want to show off how Cello makes C threading and mutexes easy. I was going to do something like write a little FIFO queue, put the pixels into the queue or maybe write an iterator for it, and then have a threadpool which consumes the pixels.
03:46:14 <korvo> But that sounds like a lot of code for a little wiki demo.
04:11:31 <ais523> I guess a good simple demo would be to map a function over a large range of integers and sum the results, although I'm not sure offhand what functions would be easy to implement and yet not allow you to get the sum into closed form
04:11:35 <ais523> anyway, I should go to bed
04:11:42 -!- ais523 has quit (Quit: quit).
05:05:34 -!- SGautam has joined.
07:25:38 <b_jonas> perlbot oeis 1,2,4,8,16,31
07:25:39 <perlbot> b_jonas: http://oeis.org/searchs?q=1%2C2%2C4%2C8%2C16%2C31 A102726(1/72) Number of compositions of the integer n into positive parts that avoid a fixed pattern of three letters.: 1,1,2,4,8,16,31,60,114,214,398,732,1334,2410,4321,7688,13590,23869,41686,72405,125144,215286,368778,629156,1069396,1811336,3058130,5147484,8639976,14463901,24154348,40244877,669115... [Output truncated. http://perl.bot/p/5eyflq ]
07:26:28 <b_jonas> though for this search there are lots of hits so you'll need more terms
07:44:05 <esolangs> [[Special:Log/upload]] upload * Galvandi * uploaded "[[File:DominoScript-Example-Factorial-flow.png]]"
07:46:08 -!- Sgeo has quit (Read error: Connection reset by peer).
07:50:50 <esolangs> [[Special:Log/upload]] upload * Galvandi * uploaded "[[File:DominoScript-Example-WASD-Input-Example-Flow.png]]"
08:04:58 -!- SGautam has quit (Quit: Connection closed for inactivity).
08:08:39 -!- tromp has joined.
09:01:50 <esolangs> [[DominoScript]] N https://esolangs.org/w/index.php?oldid=149693 * Galvandi * (+7719) initial dominoscript documentation
09:03:07 -!- craigo has joined.
09:06:50 <esolangs> [[DominoScript]] https://esolangs.org/w/index.php?diff=149694&oldid=149693 * Galvandi * (+9487) Adding new sections
09:09:10 <esolangs> [[DominoScript]] https://esolangs.org/w/index.php?diff=149695&oldid=149694 * Galvandi * (+30788) Added section about instructions
09:10:47 <esolangs> [[DominoScript]] https://esolangs.org/w/index.php?diff=149696&oldid=149695 * Galvandi * (+15827) Added section about NavigatioModes & Examples
09:19:06 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=149697&oldid=149638 * Galvandi * (+19) Added DominoScript to the list
09:21:15 <esolangs> [[User:Galvandi]] N https://esolangs.org/w/index.php?oldid=149698 * Galvandi * (+63) Initial my user page
10:33:27 -!- __monty__ has joined.
10:37:37 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:43:54 -!- tromp has joined.
11:02:13 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=149699&oldid=149684 * None1 * (+1004) /* Examples */ add brainfuck
11:08:32 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=149700&oldid=149699 * None1 * (+156) /* brainfuck */
11:11:11 -!- amby has joined.
11:54:37 <esolangs> [[User:I am islptng/Template:Signature]] https://esolangs.org/w/index.php?diff=149701&oldid=149608 * I am islptng * (+478)
12:02:51 -!- mtm has quit (Ping timeout: 246 seconds).
12:05:07 -!- mtm has joined.
12:28:50 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:33:21 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=149702&oldid=149549 * None1 * (+67) /* My Esolangs */
12:35:23 <esolangs> [[User:None1]] M https://esolangs.org/w/index.php?diff=149703&oldid=149702 * None1 * (+0) /* My Esolangs */ Oh I almost forgot
12:50:14 <esolangs> [[Whole]] N https://esolangs.org/w/index.php?oldid=149704 * None1 * (+375) Created page with "'''Whole''' is an esolang invented by [[User:None1]]. It is a version of [[]] that uses English letters. ==Commands== <pre> Whole Corresponding word _______________________________ h hole q question e exclamation w warning </pre> ==E
12:52:13 <esolangs> [[Whole]] https://esolangs.org/w/index.php?diff=149705&oldid=149704 * None1 * (+107)
12:53:01 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149706&oldid=111983 * None1 * (+26) /* Example Programs */
12:53:29 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=149707&oldid=149706 * None1 * (-2) /* See also */
13:05:06 <esolangs> [[Whole]] https://esolangs.org/w/index.php?diff=149708&oldid=149705 * None1 * (+306)
13:07:20 <esolangs> [[Whole]] https://esolangs.org/w/index.php?diff=149709&oldid=149708 * None1 * (+2) /* Variants */ not i
13:10:45 <esolangs> [[Whole]] https://esolangs.org/w/index.php?diff=149710&oldid=149709 * None1 * (+87) /* Examples */
13:15:21 <esolangs> [[Joke language list]] https://esolangs.org/w/index.php?diff=149711&oldid=147971 * None1 * (+53) /* General languages */
13:16:12 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=149712&oldid=149703 * None1 * (+54) /* My Esolangs */
13:18:34 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=149713&oldid=149349 * None1 * (+362)
13:21:15 <esolangs> [[!I!M!P!O!S!S!I!B!L!E!]] https://esolangs.org/w/index.php?diff=149714&oldid=108657 * None1 * (+15)
13:22:45 <esolangs> [[Template:Infobox proglang]] https://esolangs.org/w/index.php?diff=149715&oldid=126878 * None1 * (+25)
13:23:13 <esolangs> [[!I!M!P!O!S!S!I!B!L!E!]] M https://esolangs.org/w/index.php?diff=149716&oldid=149714 * None1 * (-15)
13:25:38 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149717&oldid=149707 * None1 * (+18) /* See also */ add year
13:41:01 -!- tromp has joined.
14:08:19 <esolangs> [[Special:Log/upload]] upload * ZachChecksOutEsolangs * uploaded "[[File:OK FINE!!!.png]]": The logo for the "OK FINE!!!" esolang
14:19:33 <esolangs> [[Talk:Whole]] N https://esolangs.org/w/index.php?oldid=149719 * I am islptng * (+597) Created page with "I think you misspelled the title. whole adj. hole n. ~~~~"
14:27:42 <esolangs> [[^]] https://esolangs.org/w/index.php?diff=149720&oldid=139345 * I am islptng * (+114)
14:31:09 -!- ais523 has joined.
14:31:24 <esolangs> [[^Romn]] N https://esolangs.org/w/index.php?oldid=149721 * I am islptng * (+1723) Created page with "{| class="wikitable" |+ Commands |- ! Romanian !! English !! Meaning |- | Spune "[text]" || Print "[text]" || Prints a string of text |- | Spune [variabilul] || Output [variable] || Outputs the value of a variable |- | Ia [variabilul] || Input [variable] / Enter [var
14:33:51 <esolangs> [[Talk:^Romn]] N https://esolangs.org/w/index.php?oldid=149722 * I am islptng * (+597) Created page with "[[^]]~~~~"
14:35:31 -!- FreeFull has quit.
14:39:03 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149723&oldid=149657 * I am islptng * (+93) /* Please ban User:ZCX islptng. */
14:45:32 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149724&oldid=149723 * Ais523 * (+238) /* Please ban User:ZCX islptng. */ MediaWiki isn't designed to replace old links to userpages
14:47:52 <esolangs> [[User talk:Ais523/Archive2]] N https://esolangs.org/w/index.php?oldid=149725 * Ais523 * (+61405) archiving my talk page
14:48:00 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149726&oldid=149724 * Ais523 * (-61373) archiving
15:08:34 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149727&oldid=149726 * I am islptng * (+88) /* Please ban User:ZCX islptng. */
15:32:41 -!- FreeFull has joined.
15:41:55 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149728&oldid=149592 * Juanp32 * (+124) /* Commands */
15:43:19 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149729&oldid=149728 * Juanp32 * (+0) TYPO ARGH
15:50:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
15:57:02 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149730&oldid=149727 * Aadenboy * (+369) /* Please ban User:ZCX islptng. */
15:57:47 -!- citrons has quit (Ping timeout: 244 seconds).
15:59:48 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaNumerals.png]]": add background
16:00:18 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaNop.png]]": add background
16:00:39 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaInput.png]]": add background
16:02:25 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutput.png]]": upward right-barbed arrow
16:03:44 -!- citrons has joined.
16:03:44 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaConditionals.png]]": slanted line with bisecting horizontal segment
16:05:29 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaJumps.png]]": 45 angle with vertical segment underneath
16:13:03 -!- tromp has joined.
16:50:27 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaModifierWithTwo.png]]": left bar diacritic
16:50:54 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaModifierLimit.png]]": top bar diacritic
16:51:15 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaModifierAsOne.png]]": right bar diacritic
16:51:37 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaModifierNegate.png]]": bottom bar diacritic
17:06:19 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=149741&oldid=149663 * Ais523 * (-16) /* 2025 */ clarify
17:07:46 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=149742&oldid=149741 * Ais523 * (+0) /* 2025 */ fix an incorrect word
17:17:32 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaModifierSequentially.png]]": left downward-barbed arrow
17:45:46 <esolangs> [[Special:Log/newusers]] create * AdjectiveNounNumber * New user account
18:03:30 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149744&oldid=149664 * AdjectiveNounNumber * (+181)
18:04:05 <esolangs> [[User talk:AdjectiveNounNumber]] N https://esolangs.org/w/index.php?oldid=149745 * AdjectiveNounNumber * (+1) Created page with "e"
18:26:38 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:29:27 <esolangs> [[Convert]] N https://esolangs.org/w/index.php?oldid=149746 * AdjectiveNounNumber * (+28) Created page with "{{wrongtitle|title=->}} WIP"
18:33:10 -!- Lord_of_Life_ has joined.
18:34:57 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:34:57 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:53:30 -!- SGautam has joined.
18:59:21 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149747&oldid=149746 * AdjectiveNounNumber * (+752)
19:05:16 -!- tromp has joined.
19:07:21 <esolangs> [[Special:Log/move]] move * 47 * moved [[Befalse]] to [[Befalse (Ian Osgood)]]: thought of making a language with the same name so...
19:07:49 <esolangs> [[Special:Log/move]] move * 47 * moved [[TIB-472 Calculator]] to [[Befalse (Ractangle)]]
19:10:19 <esolangs> [[Befalse (Ractangle)]] https://esolangs.org/w/index.php?diff=149752&oldid=149750 * 47 * (-277) will come up with syntax later
19:12:55 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopConcatenate.png]]": nop + with two
19:13:12 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopAbsoluteValue.png]]": nop + limit
19:13:34 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopBooleanify.png]]": nop + as one
19:13:49 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopNegate.png]]": nop + negate
19:14:11 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopModulo.png]]": nop + with two + limit
19:14:44 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopAdd.png]]": nop + with two + as one
19:15:05 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopSplit.png]]": nop + with two + negate
19:16:10 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopFirstDigit.png]]": nop + limit + as one
19:16:40 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopRound.png]]": nop + limit + negate
19:16:57 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopSign.png]]": nop + as one + negate
19:17:34 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopMaximum.png]]": nop + with two + limit + as one
19:17:42 <esolangs> [[Befalse (Ractangle)]] https://esolangs.org/w/index.php?diff=149764&oldid=149752 * 47 * (+280)
19:18:06 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopDivide.png]]": nop + with two + as one + negate
19:18:29 <esolangs> [[File:KawaNopDivide.png]] M https://esolangs.org/w/index.php?diff=149766&oldid=149765 * Aadenboy * (-1) /* Summary */ wrong
19:18:56 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopSubtract.png]]": nop + with two + as one + negate
19:19:20 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopLastDigit.png]]": nop + limit + as one + negate
19:19:47 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaNopMinimum.png]]": nop + with two + limit + as one + negate
19:30:35 <esolangs> [[Befalse (Ractangle)]] https://esolangs.org/w/index.php?diff=149770&oldid=149764 * 47 * (-58) /* Commands */
19:30:50 <esolangs> [[Befalse (Ractangle)]] https://esolangs.org/w/index.php?diff=149771&oldid=149770 * 47 * (-12) /* Commands */
19:33:15 <esolangs> [[Befalse (Ractangle)]] https://esolangs.org/w/index.php?diff=149772&oldid=149771 * 47 * (+28) /* Commands */
19:58:05 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149773&oldid=149676 * 47 * (-11) /* Stuff to continue */
19:58:33 <esolangs> [[Special:Log/move]] move_redir * 47 * moved [[Befalse (Ian Osgood)]] to [[Befalse]] over redirect
19:58:33 <esolangs> [[Special:Log/delete]] delete_redir * 47 * 47 deleted redirect [[Befalse]] by overwriting: Deleted to make way for move from "[[Befalse (Ian Osgood)]]"
19:59:01 <esolangs> [[Special:Log/move]] move * 47 * moved [[Befalse (Ractangle)]] to [[Befalsia]]
19:59:30 <esolangs> [[Befalsia]] https://esolangs.org/w/index.php?diff=149778&oldid=149776 * 47 * (-6)
20:00:35 -!- visilii_ has joined.
20:03:56 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149779&oldid=149747 * AdjectiveNounNumber * (+116)
20:04:40 -!- visilii has quit (Ping timeout: 265 seconds).
20:14:20 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149780&oldid=149779 * AdjectiveNounNumber * (+93)
20:15:58 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:17:51 -!- tromp has joined.
20:18:39 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149781&oldid=149780 * AdjectiveNounNumber * (-28)
20:19:11 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149782&oldid=149781 * AdjectiveNounNumber * (-3)
20:20:12 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149783&oldid=149782 * AdjectiveNounNumber * (+45)
20:35:16 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149784&oldid=149680 * Calculus is fun * (+1835) Added Input and output
20:37:02 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149785&oldid=149784 * Calculus is fun * (-12) /* IO & strings */
20:43:54 -!- craigo has quit (Quit: Leaving).
20:44:18 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149786&oldid=149785 * Calculus is fun * (+239) /* Behavior */
20:46:13 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149787&oldid=149786 * Calculus is fun * (+2) moved 99bobotw example
20:53:10 <esolangs> [[Special:Log/newusers]] create * AceDoesStuff * New user account
20:53:23 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:30:25 <esolangs> [[Uhidklol]] https://esolangs.org/w/index.php?diff=149788&oldid=149526 * Juanp32 * (+32) /* instructions */ added `q` command (which is shamelessly stolen off ed(1) lol)
21:33:38 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaInputWithTwo.png]]": input + with two
21:34:02 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaInputLimit.png]]": input + limit
21:34:28 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaInputLimitSequentially.png]]": input + limit + sequentially
21:51:28 -!- tromp has joined.
22:02:56 -!- SGautam has quit (Quit: Connection closed for inactivity).
22:07:59 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:02:22 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149792&oldid=149787 * Calculus is fun * (+205) Added a cat *meow*
23:04:28 <esolangs> [[Talk:Whole]] https://esolangs.org/w/index.php?diff=149793&oldid=149719 * None1 * (+396)
23:18:05 -!- __monty__ has quit (Quit: leaving).
00:02:57 -!- mtm has quit (Ping timeout: 265 seconds).
00:04:26 -!- Sgeo has joined.
00:06:29 -!- mtm has joined.
00:33:13 <esolangs> [[Meow (Martsadas)]] https://esolangs.org/w/index.php?diff=149794&oldid=119744 * Kaveh Yousefi * (+12) Rectified a few logical errors in the example programs 99 bottles of beer and Factorial, as well as an aesthetical blemish in the FizzBuzz example.
00:35:04 <esolangs> [[Meow (Martsadas)]] https://esolangs.org/w/index.php?diff=149795&oldid=149794 * Kaveh Yousefi * (+199) Added a hyperlink to my implementation of the Meow programming language on GitHub and supplemented the Implemented category tag.
00:42:25 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaInputAsOne.png]]": input + as one
00:42:36 <esolangs> [[Meow (Martsadas)]] https://esolangs.org/w/index.php?diff=149797&oldid=149795 * Kaveh Yousefi * (+208) Supplemented references to the register names in the instruction table and reformatted operations as code fragments.
00:42:44 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaLimitNegate.png]]": kawa + limit + negate
00:43:13 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutputWithTwo.png]]": output + with two
00:43:44 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutputLimitAsOne.png]]": output + limit + as one
00:44:02 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutputAsOne.png]]": output + as one
00:44:23 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutputNegate.png]]": output + negate
00:44:45 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaOutputSequentially.png]]": output + sequentially
00:45:06 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfWithTwo.png]]": if + with two
00:45:25 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfLimit.png]]": if + limit
00:45:41 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfNegate.png]]": if + negate
00:46:08 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfSequentially.png]]": if + sequentially
00:46:29 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfSequentiallyAsOne.png]]": if + sequentially + as one
00:46:51 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaIfSequentiallyWithTwo.png]]": if + sequentially + with two
01:22:42 -!- m5zs7k has quit (Ping timeout: 265 seconds).
01:24:08 -!- m5zs7k has joined.
01:30:12 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticSequentially.png]]": left downward-barbed arrow
01:30:41 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticPushTop.png]]": upward chevron
01:31:01 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticPushBottom.png]]": upward arch
01:31:24 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticPopTop.png]]": downward chevron
01:31:44 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticPopBottom.png]]": downward arch
01:32:12 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticAsTwo.png]]": diaeresis
01:32:32 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticDiscard.png]]": squiggle
01:39:11 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaHelloWorld.png]]": [[Hello, World!]] in [[Kawa]]
01:44:27 -!- ais523 has quit (Ping timeout: 265 seconds).
01:58:31 -!- ais523 has joined.
01:59:28 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaFibonacci.png]]": [[Fibonacci sequence]] in [[Kawa]]
01:59:56 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticFlag.png]]": short T
02:03:16 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaTruthMachine.png]]": [[Truth-machine]] in [[Kawa]]
02:03:48 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaCat.png]]": [[Cat program]] in [[Kawa]]
02:05:00 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaJumpBack.png]]"
02:43:37 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:52:31 -!- yewscion has joined.
02:58:10 -!- ais523 has quit (Quit: quit).
03:40:43 <esolangs> [[Kawa]] N https://esolangs.org/w/index.php?oldid=149823 * Aadenboy * (+9826) Created page with "{{infobox proglang |name=Kawa |paradigms=? |author=[[User:Aadenboy]] |year=[[:Category:2025|2025]] |memsys=Deque, stack |dimensions=One-dimensional |refimp=[https://github.com/aadenboy/Kawa-IDE aadenboy/Kawa-IDE] |class=[[:Category:Turing complete|Turing complete]]<sup><i
03:41:34 <esolangs> [[User:Aadenboy]] https://esolangs.org/w/index.php?diff=149824&oldid=149123 * Aadenboy * (+70) /* MY ESOLANGS */ add [[Kawa]]
03:42:32 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=149825&oldid=149697 * Aadenboy * (+11) /* K */ add [[Kawa]]
03:43:07 <esolangs> [[Semi-serious language list]] M https://esolangs.org/w/index.php?diff=149826&oldid=148517 * Aadenboy * (+11) /* K */ add Kawa
03:48:25 <korvo> Oh, *that's* why they needed all of those images.
03:55:14 <esolangs> [[Hello world program in esoteric languages (H-M)]] M https://esolangs.org/w/index.php?diff=149827&oldid=145778 * Aadenboy * (+42) add [[Kawa]]
03:56:52 <esolangs> [[Truth-machine]] M https://esolangs.org/w/index.php?diff=149828&oldid=149679 * Aadenboy * (+45) add [[Kawa]]
03:57:39 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=149829&oldid=149823 * Aadenboy * (+31) distinguish confusion
03:57:59 <esolangs> [[Kava]] M https://esolangs.org/w/index.php?diff=149830&oldid=141031 * Aadenboy * (+31) distinguish confusion
04:13:48 -!- yewscion has quit (Ping timeout: 265 seconds).
06:02:35 -!- craigo has joined.
07:08:54 -!- Sgeo has quit (Read error: Connection reset by peer).
07:24:03 -!- tromp has joined.
09:26:56 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:44:24 -!- __monty__ has joined.
10:39:36 -!- tromp has joined.
11:48:28 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=149831&oldid=149581 * UrnEn * (+40)
11:50:02 -!- __monty__ has quit (Ping timeout: 252 seconds).
12:01:06 -!- __monty__ has joined.
12:02:29 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:46 -!- mtm has joined.
12:14:12 <esolangs> [[Special:Log/newusers]] create * Blashyrkh * New user account
12:19:23 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149832&oldid=149744 * Blashyrkh * (+186) /* Introductions */
12:46:58 <esolangs> [[Special:Log/upload]] upload * Blashyrkh * uploaded "[[File:Fire.png]]"
12:50:29 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149834&oldid=149259 * Blashyrkh * (+222) /* Programs */ Fire program uploaded
13:40:57 -!- amby has joined.
13:43:55 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:12:55 <esolangs> [[Special:Log/newusers]] create * ClearLimediWater * New user account
14:25:39 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149835&oldid=149832 * ClearLimediWater * (+207)
14:33:16 <esolangs> [[User:ClearLimediWater]] N https://esolangs.org/w/index.php?oldid=149836 * ClearLimediWater * (+21) Created page with ""
15:36:19 -!- Sgeo has joined.
15:46:37 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149837&oldid=149783 * AdjectiveNounNumber * (+12)
15:53:12 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149838&oldid=149837 * AdjectiveNounNumber * (+96)
15:56:40 -!- Everything has joined.
16:14:54 -!- Everythi1g has joined.
16:15:13 -!- Everything has quit (Quit: leaving).
16:15:15 -!- Everythi1g has quit (Client Quit).
16:15:34 -!- Everything has joined.
16:57:59 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=149839&oldid=149420 * TheCanon2 * (+53) Added Disan Count
17:11:13 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149840&oldid=149838 * AdjectiveNounNumber * (+463)
17:12:30 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=149841&oldid=149839 * TheCanon2 * (+10) When an even number is run through Disan Count, the output doesn't include the input itself.
17:14:46 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149842&oldid=149840 * AdjectiveNounNumber * (-32)
17:18:57 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149843&oldid=149828 * AdjectiveNounNumber * (+103)
17:21:23 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149844&oldid=149843 * AdjectiveNounNumber * (+6)
17:21:43 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=149845&oldid=149844 * AdjectiveNounNumber * (-1) /* -> */
17:31:01 -!- tromp has joined.
17:31:30 <int-e> `? procrastination
17:31:35 <HackEso> The Procrastination is destined to rule the world... right after watching this final funny cat clip on youtube.
17:32:21 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149846&oldid=149842 * AdjectiveNounNumber * (+29)
17:43:18 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149847&oldid=149846 * AdjectiveNounNumber * (+26)
17:45:23 <esolangs> [[User:TheCanon2]] M https://esolangs.org/w/index.php?diff=149848&oldid=149172 * TheCanon2 * (+53)
18:00:56 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:02:33 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149849&oldid=149847 * AdjectiveNounNumber * (+0) /* Syntax */
18:03:03 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149850&oldid=149849 * AdjectiveNounNumber * (-88)
18:07:52 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149851&oldid=149850 * AdjectiveNounNumber * (+191)
18:14:19 -!- tromp has joined.
18:24:08 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:28:48 -!- tromp has joined.
18:34:03 -!- Lord_of_Life_ has joined.
18:35:01 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:35:27 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:37:10 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149852&oldid=149851 * AdjectiveNounNumber * (+265) /* -> */
18:37:27 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149853&oldid=149852 * AdjectiveNounNumber * (+2) /* Examples */
18:37:41 <esolangs> [[Disan Count (language)]] N https://esolangs.org/w/index.php?oldid=149854 * TheCanon2 * (+431) Created page with "'''Disan Count''' is an esoteric programming language created by [[User:TheCanon2]] to demonstrate the insufficiency of using the [[Disan Count]] as a proof for Turing-completeness. ==Commands== Disan Count has 1 register and 2 commands. {|class="wikita
18:46:05 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149855&oldid=149853 * AdjectiveNounNumber * (+202) /* Syntax */
18:52:21 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149856&oldid=149855 * AdjectiveNounNumber * (+106)
19:03:08 -!- craigo has quit (Quit: Leaving).
19:08:19 -!- Hooloovoo has quit (Ping timeout: 252 seconds).
19:13:17 -!- visilii has joined.
19:13:20 -!- visilii_ has quit (Ping timeout: 252 seconds).
19:14:43 <esolangs> [[Disan Count (language)]] M https://esolangs.org/w/index.php?diff=149857&oldid=149854 * TheCanon2 * (+857)
19:28:39 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:48:10 <esolangs> [[Talk:Pistons & Pistons]] https://esolangs.org/w/index.php?diff=149858&oldid=79280 * Jan jelo * (+172) /* Validity? */
20:50:41 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=149859&oldid=149058 * Ractangle * (+0) /* Commands */
20:51:29 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=149860&oldid=149859 * Ractangle * (+0) /* Examples */
21:02:49 -!- supercode has joined.
21:27:26 <esolangs> [[Talk:Convert]] N https://esolangs.org/w/index.php?oldid=149861 * AdjectiveNounNumber * (+1) Created page with "e"
21:35:18 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149862&oldid=149773 * Ractangle * (+1) /* Stuff to continue */
21:52:35 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149863&oldid=149834 * Blashyrkh * (+64) /* Programs */ Add link to fire.BytePusher's source code
21:53:48 <esolangs> [[Kawa]] https://esolangs.org/w/index.php?diff=149864&oldid=149829 * Aadenboy * (+188) /* With If */
21:57:06 -!- Hooloovoo has joined.
22:23:41 -!- Everything has quit (Quit: leaving).
22:30:57 -!- tromp has joined.
22:31:29 -!- tromp has quit (Client Quit).
22:37:09 -!- tromp has joined.
22:43:32 -!- FreeFull has quit (Ping timeout: 265 seconds).
22:44:39 -!- Hooloovoo has quit (Ping timeout: 244 seconds).
22:56:05 -!- Hooloovoo has joined.
23:21:27 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:51:59 -!- __monty__ has quit (Quit: leaving).
00:03:46 -!- mtm has quit (Ping timeout: 265 seconds).
00:05:14 -!- mtm has joined.
00:22:50 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=149865&oldid=149618 * I am islptng * (+75)
01:27:22 -!- supercode has quit (Quit: Client closed).
01:29:17 <esolangs> [[TypeString]] https://esolangs.org/w/index.php?diff=149866&oldid=125431 * GUAqwq * (-30) /* Turing Complete */
01:48:03 <esolangs> [[Special:Log/newusers]] create * True-grue * New user account
02:01:07 <esolangs> [[User:I am islptng/Sandbox]] https://esolangs.org/w/index.php?diff=149867&oldid=149604 * I am islptng * (-5653) Goodbye, GaoErFu!
02:26:16 -!- iovoid has quit (Excess Flood).
02:26:19 -!- Bowserinator has quit (Remote host closed the connection).
02:27:26 -!- iovoid has joined.
02:27:44 -!- Bowserinator has joined.
02:36:21 -!- Bowserinator has quit (Ping timeout: 246 seconds).
02:36:30 -!- iovoid has quit (Ping timeout: 265 seconds).
02:36:39 -!- Bowserinator has joined.
02:36:45 -!- iovoid has joined.
02:41:25 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
04:29:45 <esolangs> [[Push-up automaton]] N https://esolangs.org/w/index.php?oldid=149868 * BestCoder * (+52) Created page with "hypothetically the opposite of a push-down automaton"
04:32:44 <esolangs> [[Category talk:Turning tarpits]] https://esolangs.org/w/index.php?diff=149869&oldid=138297 * BestCoder * (+60)
04:34:30 <esolangs> [[Talk:Xand]] https://esolangs.org/w/index.php?diff=149870&oldid=129853 * BestCoder * (+24)
04:34:44 <esolangs> [[Category:Discussion]] N https://esolangs.org/w/index.php?oldid=149871 * BestCoder * (+26) Created page with "a category for discussions"
04:34:59 <esolangs> [[Category talk:Discussion]] N https://esolangs.org/w/index.php?oldid=149872 * BestCoder * (+9) Created page with "recursion"
04:35:30 <esolangs> [[Category talk:Discussion]] https://esolangs.org/w/index.php?diff=149873&oldid=149872 * BestCoder * (+24)
04:39:02 <esolangs> [[User:Aadenboy/00=0]] N https://esolangs.org/w/index.php?oldid=149874 * Aadenboy * (+3402) read! fun little idea I had
04:40:14 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=149875&oldid=149824 * Aadenboy * (+27) /* anything else */ add [[User:Aadenboy/00=0|00=0]]
04:41:58 <esolangs> [[Category talk:Discussion]] https://esolangs.org/w/index.php?diff=149876&oldid=149873 * Aadenboy * (+367)
05:36:00 <esolangs> [[User:Aadenboy/00=0]] M https://esolangs.org/w/index.php?diff=149877&oldid=149874 * Aadenboy * (+86) fix
05:48:57 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149878&oldid=149792 * Calculus is fun * (+93) Edit of intro paragraph.
05:53:47 <esolangs> [[User:Aadenboy/00=0]] M https://esolangs.org/w/index.php?diff=149879&oldid=149877 * Aadenboy * (+91)
06:44:41 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=149880&oldid=149878 * Calculus is fun * (+629) Ackermann example
07:21:19 -!- tromp has joined.
07:41:33 -!- Sgeo has quit (Read error: Connection reset by peer).
08:38:06 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:16:08 -!- tromp has joined.
09:54:26 -!- craigo has joined.
09:55:07 -!- fowl has quit (Quit: Ping timeout (120 seconds)).
09:55:37 -!- fowl has joined.
10:51:39 <esolangs> [[User:Calculus is fun]] N https://esolangs.org/w/index.php?oldid=149881 * Calculus is fun * (+774) Created page with "Hello, I've been programming ever since I was shown Scratch in elementary school, Since then I've jumped between Java, JavaScript, WolframScript, and more, I've seen my fair share of silly programming languages, I made a small library in JS for ratio
10:53:22 <esolangs> [[User:Calculus is fun]] M https://esolangs.org/w/index.php?diff=149882&oldid=149881 * Calculus is fun * (-24)
11:10:06 <esolangs> [[PrySigneToFry-complete]] https://esolangs.org/w/index.php?diff=149883&oldid=149463 * PrySigneToFry * (+247)
11:11:32 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=149884&oldid=149713 * PrySigneToFry * (+920)
11:13:00 <esolangs> [[]] N https://esolangs.org/w/index.php?oldid=149885 * PrySigneToFry * (+84) Created page with "{{WIP}} (yuandan) is an programming language that designed by PSTF and None1."
11:14:01 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=149886&oldid=149209 * PrySigneToFry * (+98) /* I've maded the page. */ new section
11:14:12 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=149887&oldid=149886 * PrySigneToFry * (-3) /* I've maded the page. */
11:21:23 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149888&oldid=149880 * Calculus is fun * (+268) /* Behavior */
12:01:46 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149889&oldid=149885 * PrySigneToFry * (+3667)
12:03:09 -!- mtm has quit (Ping timeout: 276 seconds).
12:04:41 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149890&oldid=149543 * PrySigneToFry * (+478)
12:06:09 -!- mtm has joined.
12:21:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:22:39 -!- tromp has joined.
12:44:54 -!- craigo_ has joined.
12:45:40 -!- craigo has quit (Ping timeout: 252 seconds).
12:48:39 <esolangs> [[Cursor]] N https://esolangs.org/w/index.php?oldid=149891 * AdjectiveNounNumber * (+640) Created page with "Cursor is a 2-dimensional [[Esoteric programming language|esolang]] created by on Jan 10 2025 7:42 ET where you can control propertys of the cursor. (VERY WIP) {| class="wikitable" |+ Component Summarys |- ! Symbol !! Name !! Summary |- | * || Start || Start
13:22:26 -!- lisbeths has joined.
14:05:55 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149892&oldid=149835 * True-grue * (+141) true-grue introduction
14:06:18 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149893&oldid=149890 * None1 * (+395) /* Interpreters */
14:07:04 <esolangs> [[Esolang:Introduce yourself]] M https://esolangs.org/w/index.php?diff=149894&oldid=149892 * True-grue * (+29)
14:08:04 <esolangs> [[Special:Log/upload]] upload * True-grue * uploaded "[[File:Snow.png]]"
14:09:11 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149896&oldid=149893 * None1 * (+419) /* Type 16 */
14:16:40 <esolangs> [[Special:Log/upload]] upload * True-grue * uploaded "[[File:Small snow.png]]"
14:16:55 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149898&oldid=149889 * None1 * (+770)
14:17:16 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149899&oldid=149898 * None1 * (+29) /* Other commands */
14:17:25 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149900&oldid=149896 * PrySigneToFry * (+2401)
14:18:55 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149901&oldid=149900 * PrySigneToFry * (+17)
14:22:20 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149902&oldid=149863 * True-grue * (+200) snowfall simulation
14:28:41 -!- true-grue has joined.
14:33:11 -!- amby has joined.
14:51:44 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=149903&oldid=149902 * Blashyrkh * (+20) /* Programs */
15:00:21 -!- Sgeo has joined.
15:10:10 <esolangs> [[User talk:True-grue]] N https://esolangs.org/w/index.php?oldid=149904 * Blashyrkh * (+75) Created page with "It was your article at habr.com that acquainted me with BytePusher. Thanks!"
15:13:23 -!- true-grue has quit (Quit: Client closed).
15:14:17 -!- true-grue has joined.
15:19:26 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149905&oldid=149904 * True-grue * (+164)
15:19:36 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149906&oldid=149905 * True-grue * (+1)
15:36:24 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149907&oldid=149906 * Blashyrkh * (+390)
15:37:01 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149908&oldid=149907 * Blashyrkh * (+4)
15:39:36 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149909&oldid=149908 * Blashyrkh * (+4)
15:43:26 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149910&oldid=149909 * True-grue * (+113)
16:00:13 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:00:36 <esolangs> [[User talk:True-grue]] https://esolangs.org/w/index.php?diff=149911&oldid=149910 * Blashyrkh * (+253)
16:00:57 <esolangs> [[User:Aadenboy/Sandbox]] M https://esolangs.org/w/index.php?diff=149912&oldid=139680 * Aadenboy * (-4807) test
16:08:25 -!- tromp has joined.
16:40:40 <esolangs> [[User:Aadenboy/Program states]] N https://esolangs.org/w/index.php?oldid=149913 * Aadenboy * (+288) Created page with "mostly random ideas. zzz. == Switch-bait == A program is Switch-bait if it can: * Take an input from the user * Store the value permanently * Silently use that value within computations * Immediately change the value for something else when the use
17:27:58 -!- true-grue has quit (Quit: Client closed).
17:55:36 <esolangs> [[User:AdjectiveNounNumber]] N https://esolangs.org/w/index.php?oldid=149914 * AdjectiveNounNumber * (+6) Created page with "ijijij"
18:28:32 -!- __monty__ has joined.
18:35:38 -!- Lord_of_Life_ has joined.
18:36:24 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:37:30 -!- ais523 has joined.
18:38:35 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:39:31 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:40:35 <esolangs> [[Condit]] https://esolangs.org/w/index.php?diff=149915&oldid=140253 * 47 * (-3) /* Truth-machine */
18:40:58 <esolangs> [[Condit]] https://esolangs.org/w/index.php?diff=149916&oldid=149915 * 47 * (+0) /* Examples */
18:46:27 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=149917&oldid=149856 * AdjectiveNounNumber * (+27)
19:11:16 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149918&oldid=149730 * Aadenboy * (+356) /* category removal */ new section
19:14:19 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=149919&oldid=149875 * Aadenboy * (+56)
19:20:10 <esolangs> [[Special:Log/delete]] delete * Ais523 * deleted "[[Category:Discussion]]": undiscussed category, redundant to [[Special:AllPages/Talk:]]
19:21:15 <esolangs> [[Category talk:Discussion]] https://esolangs.org/w/index.php?diff=149920&oldid=149876 * Ais523 * (+17) nowiki link to deleted category (as it's important to understand the context of the page, which was not deleted because it helps to explain why the category was deleted)
19:21:31 <esolangs> [[Talk:Xand]] https://esolangs.org/w/index.php?diff=149921&oldid=149870 * Ais523 * (-24) rm deleted category
19:22:10 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=149922&oldid=149918 * Ais523 * (+269) /* category removal */ deleted
19:35:39 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149923&oldid=149678 * 47 * (+106)
19:44:33 -!- tromp has joined.
20:09:32 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:11:52 -!- tromp has joined.
20:28:30 <esolangs> [[User:Aadenboy/Program states]] https://esolangs.org/w/index.php?diff=149924&oldid=149913 * Aadenboy * (-288) never mind! this is dumb! aagh!
20:42:39 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:44:38 -!- tromp has joined.
20:59:08 -!- supercode has joined.
21:01:52 -!- lisbeths has quit (Quit: Connection closed for inactivity).
22:03:18 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:14:39 -!- tromp has joined.
22:25:39 -!- __monty__ has quit (Quit: leaving).
22:37:04 -!- FreeFull has joined.
23:21:25 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
00:04:00 -!- mtm has quit (Ping timeout: 246 seconds).
00:05:50 -!- mtm has joined.
00:07:19 <esolangs> [[User:Aadenboy/00=0]] M https://esolangs.org/w/index.php?diff=149925&oldid=149879 * Aadenboy * (-148) thanks render errors
00:42:07 -!- supercode has quit (Quit: Client closed).
00:44:19 -!- craigo__ has joined.
00:47:00 -!- craigo_ has quit (Ping timeout: 252 seconds).
01:28:32 <ais523> reading my mailserver log for weird things happening, I saw an HTTP request to the SMTP submission port, which looks a bit like it might be from a search engine
01:29:05 <ais523> it looks like it followed a link to the IP+port pair
01:29:31 <ais523> and, well, anyone can put a link to any IP+port pair onto the web, but I'm vaguely surprised that someone actually did
01:31:17 <int-e> hmm. search engines might pick up on something like foo.bar:123 and try HTTP requests there?
01:31:53 <int-e> in these desparate times where we need every byte of training material for LLMs that we can find
01:32:43 <ais523> I don't know why anyone would even have a link to my SMTP submission port, it's not like it's usable by anyone but me
01:33:07 <ais523> my guess is that it's on some sort of list intended for use by spammers, who don't know how many of the ports are usable (but must surely suspect that most of them aren't)
01:33:29 <int-e> it could just be a weird port scan too
01:33:53 <ais523> port scans don't usually send HTTP requests but I guess they *could*
01:34:46 <int-e> Anyway, all I have is speculation. This doesn't sound familiar in any way :)
01:35:28 <ais523> right, it was weird enough to be worth commenting on :-)
01:35:47 <ais523> it likely isn't a problem – mailservers get so many random attacks as it is – but it's strange enough to have made me curious
01:36:44 <int-e> Like... I keep looking at spam mails and wondering what the underlying scam is. Which is about equally fruitless.
01:37:20 <ais523> in some of them, the scam appears to have been perpetrated against the sender, who has been falsely convinced by some spambot vender that the spam mail will do something useful
01:37:41 <int-e> Subject: Mail delivery failed: returning message to sender <-- meh, is that still a spam delivery vector
01:37:54 <ais523> spam with unsubstituted placeholders is always fun, when you get a literal "$FEMALE_NAME" in the email rather than a random female name
01:38:36 <ais523> apparently many spammers don't test their spamcannons very thoroughly
01:51:21 <zzo38> I have seen TLS client hello messages on port 80 of my server
01:58:32 <zzo38> On my SMTP server, I have gotten HTTP requests, TLS client hello messages, JSON (something relating to Ethereum mining, it seems), and attempts to send messages to email addresses that do not exist on my server, and attempts at relaying messages (which are rejected by my server).
01:59:12 <int-e> Is that what "\x16\x03\x01" is? Hmm.
01:59:52 <zzo38> I think "\x16\x03\x01" is the beginning of a TLS client hello message.
02:00:24 <int-e> What are things like GET /.env scanning for?
02:00:47 <zzo38> I don't know what that is.
02:05:28 <int-e> Huh, this one is odd too. GET /+CSCOE+/logon.html ..."CSCOE is a nonprofit organization that transforms Catholic education through innovative and entrepreneurial approaches."
02:05:28 <zzo38> (scorpiond does not currently log all invalid requests, although I could change that. So, I don't know if any HTTP requests or TLS client hello messages are received on that server. Actually the specification says that TLS client hello is valid, but that servers are not required to implement it, and currently it is not implemented.)
02:06:14 <int-e> I guess that makes sense if they provide IT support (setting up web servers for schools)
02:07:22 <int-e> But whatever... still the usual scans with a few fun outliers, though the .env thing was new to me.
02:12:59 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=149926&oldid=149888 * Calculus is fun * (+6) /* Commands */
02:28:36 -!- moony has quit (Quit: leaving).
02:29:46 -!- moony has joined.
02:57:07 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:05:13 -!- nitrix has quit (Quit: ZNC 1.8.2 - https://znc.in).
03:06:16 -!- nitrix has joined.
03:22:42 -!- nitrix has quit (Quit: ZNC 1.8.2 - https://znc.in).
03:23:43 -!- nitrix has joined.
04:21:26 <esolangs> [[User:PrySigneToFry/Sandbox/My Rate to the user that I know]] https://esolangs.org/w/index.php?diff=149927&oldid=148893 * PrySigneToFry * (+1) ZCX islptng was changed his username to I am islptng, so I had to fix the username
04:33:04 -!- ais523 has quit (Ping timeout: 260 seconds).
04:36:53 <esolangs> [[Talk:Uyjhmn n]] https://esolangs.org/w/index.php?diff=149928&oldid=142449 * PrySigneToFry * (+94) /* ? */ new section
04:38:10 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=149929&oldid=149825 * PrySigneToFry * (+13)
04:40:15 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149930&oldid=149901 * PrySigneToFry * (+334)
04:52:52 -!- ais523 has joined.
04:55:54 <esolangs> [[Luke's Box Programming]] N https://esolangs.org/w/index.php?oldid=149931 * ClearLimediWater * (+280) Created page with "'''Luke's Box Programming'''LBP[[User:ClearLimediWater]][[esoteric programming language|Esolang]] '''Luke's Box Programming''' (abbreviated as LBP) is an [[esoteric programming language]] made by [[User:ClearLimediWater]]. [[Category:Languages]]
05:00:17 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=149932&oldid=149929 * ClearLimediWater * (+42)
05:13:03 <esolangs> [[Definitely unusable]] M https://esolangs.org/w/index.php?diff=149933&oldid=144715 * PrySigneToFry * (+274)
05:18:07 <esolangs> [[Special:Log/newusers]] create * SerialDesignationF * New user account
05:30:08 -!- yewscion has joined.
05:31:23 -!- yewscion_ has joined.
05:34:44 -!- yewscion has quit (Ping timeout: 252 seconds).
05:34:53 <esolangs> [[]] https://esolangs.org/w/index.php?diff=149934&oldid=149899 * PrySigneToFry * (+436)
06:19:32 -!- yewscion_ has quit (Read error: Connection reset by peer).
06:51:49 <esolangs> [[Special:Log/newusers]] create * Edward Z * New user account
06:53:58 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=149935&oldid=149894 * Edward Z * (+69)
06:57:16 <esolangs> [[Starry]] https://esolangs.org/w/index.php?diff=149936&oldid=38232 * Edward Z * (+2311)
07:09:41 -!- craigo__ has quit (Ping timeout: 252 seconds).
07:18:28 -!- tromp has joined.
07:33:18 -!- lisbeths has joined.
08:00:59 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=149937&oldid=149923 * 47 * (+4) /* Syntax */
08:04:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
08:41:33 -!- ais523 has quit (Quit: quit).
09:14:48 -!- tromp has joined.
09:52:46 -!- lisbeths has quit (Quit: Connection closed for inactivity).
10:00:55 -!- Sgeo has quit (Read error: Connection reset by peer).
10:08:51 <esolangs> [[User talk:ClearLimediWater]] N https://esolangs.org/w/index.php?oldid=149938 * PrySigneToFry * (+39) Created page with ""
10:12:08 <esolangs> [[User:ZCX islptng]] https://esolangs.org/w/index.php?diff=149939&oldid=149597 * PrySigneToFry * (+56)
10:17:20 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149940&oldid=149729 * PrySigneToFry * (+1537)
10:20:49 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149941&oldid=149940 * PrySigneToFry * (+214)
10:24:07 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=149942&oldid=148122 * PrySigneToFry * (+978) /* Check out my(and None1's) Esolang! */ new section
10:36:17 <esolangs> [[Permission denied]] https://esolangs.org/w/index.php?diff=149943&oldid=142922 * PrySigneToFry * (+553)
11:00:37 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=149944&oldid=149884 * I am islptng * (+1191)
12:02:51 -!- mtm has quit (Ping timeout: 244 seconds).
12:05:27 -!- mtm has joined.
12:13:25 -!- DOS_User_webchat has joined.
12:20:06 -!- __monty__ has joined.
12:36:04 -!- __monty__ has quit (Quit: leaving).
12:38:26 -!- DOS_User_webchat has quit (Remote host closed the connection).
12:40:58 <esolangs> [[User talk:ClearLimediWater]] https://esolangs.org/w/index.php?diff=149945&oldid=149938 * ClearLimediWater * (+116)
12:43:02 <esolangs> [[Luke's Box Programming]] https://esolangs.org/w/index.php?diff=149946&oldid=149931 * ClearLimediWater * (-49)
12:43:45 <esolangs> [[User talk:ClearLimediWater]] https://esolangs.org/w/index.php?diff=149947&oldid=149945 * ClearLimediWater * (+6)
12:50:38 <esolangs> [[User:ClearLimediWater]] https://esolangs.org/w/index.php?diff=149948&oldid=149836 * ClearLimediWater * (+124)
12:51:30 -!- craigo__ has joined.
12:51:33 -!- craigo__ has quit (Remote host closed the connection).
12:52:27 -!- craigo has joined.
13:02:30 <esolangs> [[User talk:ClearLimediWater]] https://esolangs.org/w/index.php?diff=149949&oldid=149947 * ClearLimediWater * (+143)
13:03:31 -!- supercode has joined.
13:05:04 <esolangs> [[WaifuScript]] N https://esolangs.org/w/index.php?oldid=149950 * Juanp32 * (+1158) made this esolang to troll my cs teacher lol
13:07:55 <esolangs> [[Joke language list]] https://esolangs.org/w/index.php?diff=149951&oldid=149711 * Juanp32 * (+78) /* General languages */
13:09:19 <esolangs> [[User:Juanp32]] https://esolangs.org/w/index.php?diff=149952&oldid=149593 * Juanp32 * (+52) /* languages i made, i guess */
13:10:53 -!- DOS_User_webchat has joined.
13:12:41 <esolangs> [[WaifuScript]] M https://esolangs.org/w/index.php?diff=149953&oldid=149950 * Juanp32 * (-1) tyop
13:17:34 <esolangs> [[Special:Log/upload]] upload * ClearLimediWater * uploaded "[[File:Wankong497 01.jpg]]": CLW
13:18:05 -!- DOS_User_webchat has quit (Remote host closed the connection).
13:26:15 <esolangs> [[User:ClearLimediWater]] https://esolangs.org/w/index.php?diff=149955&oldid=149948 * ClearLimediWater * (+241)
13:32:17 <esolangs> [[User:ClearLimediWater]] M https://esolangs.org/w/index.php?diff=149956&oldid=149955 * ClearLimediWater * (+93)
13:33:41 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:54:06 -!- Guest75 has joined.
13:54:34 -!- Guest75 has quit (Client Quit).
13:54:51 <esolangs> [[Luke's Box Programming]] https://esolangs.org/w/index.php?diff=149957&oldid=149946 * ClearLimediWater * (+1274)
14:00:03 -!- DOS_User_webchat has joined.
14:00:31 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=149958&oldid=149841 * TheCanon2 * (+74) grammar
14:03:58 -!- amby has joined.
14:16:48 -!- DOS_User_webchat has quit (Remote host closed the connection).
14:18:29 -!- DOS_User_webchat has joined.
14:18:33 -!- DOS_User_webchat has quit (Remote host closed the connection).
14:46:24 <esolangs> [[User:ZCX islptng]] https://esolangs.org/w/index.php?diff=149959&oldid=149939 * 47 * (-56) pstf shut up
14:47:39 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149960&oldid=149941 * 47 * (-1751) and?
14:48:04 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=149961&oldid=149960 * 47 * (+1537)
15:06:49 -!- tromp has joined.
15:33:13 -!- supercode has quit (Quit: Client closed).
15:44:46 <esolangs> [[Special:Log/upload]] upload * ZachChecksOutEsolangs * uploaded "[[File:Factorial Program.png]]"
15:45:12 <esolangs> [[Black Pentagon]] https://esolangs.org/w/index.php?diff=149963&oldid=144775 * ZachChecksOutEsolangs * (+67)
15:45:41 <esolangs> [[Black Pentagon]] https://esolangs.org/w/index.php?diff=149964&oldid=149963 * ZachChecksOutEsolangs * (+0)
15:46:07 <esolangs> [[Black Pentagon]] https://esolangs.org/w/index.php?diff=149965&oldid=149964 * ZachChecksOutEsolangs * (+0)
15:46:26 <esolangs> [[Black Pentagon]] https://esolangs.org/w/index.php?diff=149966&oldid=149965 * ZachChecksOutEsolangs * (+0)
15:46:34 -!- lisbeths has joined.
15:47:46 <esolangs> [[Black Pentagon]] https://esolangs.org/w/index.php?diff=149967&oldid=149966 * ZachChecksOutEsolangs * (+116)
15:58:18 -!- supercode has joined.
15:59:58 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:27:13 -!- tromp has joined.
16:52:53 <esolangs> [[WaidWmy]] https://esolangs.org/w/index.php?diff=149968&oldid=146980 * AlmostGalactic * (+557)
17:26:46 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:36:00 -!- tromp has joined.
17:41:20 <esolangs> [[GotoScript]] https://esolangs.org/w/index.php?diff=149969&oldid=119909 * Quito0567 * (+1)
18:36:10 -!- Lord_of_Life_ has joined.
18:37:10 -!- Lord_of_Life has quit (Ping timeout: 260 seconds).
18:37:33 -!- lisbeths has quit (Quit: Connection closed for inactivity).
18:39:08 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:40:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:01:49 <esolangs> [[Translated /tommyaweosme]] N https://esolangs.org/w/index.php?oldid=149970 * Tommyaweosme * (+1100) Created page with " - Paliraworld.kgm - Paliraworld.kgm 2016-2021 -Paliraworld.kgm Paliraworld.kgm Paliraworld.kgm ..."
19:02:29 <esolangs> [[Translated /PSTF Again2]] https://esolangs.org/w/index.php?diff=149971&oldid=146375 * Tommyaweosme * (+66)
19:06:48 -!- tromp has joined.
19:26:17 -!- Sgeo has joined.
19:45:42 <esolangs> [[Special:Log/move]] move * 47 * moved [[Befalsia]] to [[Switch gr]]
19:46:44 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149974&oldid=149972 * 47 * (+71)
19:49:36 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149975&oldid=149974 * 47 * (-146)
19:53:37 <esolangs> [[Special:Log/upload]] upload * 47 * uploaded "[[File:Off default.png]]"
19:55:41 <esolangs> [[Special:Log/upload]] upload * 47 * uploaded "[[File:On default.png]]"
19:57:14 <esolangs> [[Special:Log/upload]] upload * 47 * uploaded "[[File:Off alt.png]]"
19:58:13 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149979&oldid=149975 * 47 * (+199) /* Swiches */
19:58:26 <esolangs> [[Special:Log/upload]] upload * 47 * uploaded "[[File:On alt.png]]"
19:59:58 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149981&oldid=149979 * 47 * (-3)
20:00:28 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149982&oldid=149981 * 47 * (+3)
20:05:22 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=149983&oldid=149982 * 47 * (+114)
20:11:11 -!- __monty__ has joined.
20:16:34 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149984&oldid=149862 * Ractangle * (+1) /* Stuff to continue */
20:16:56 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149985&oldid=149984 * Ractangle * (-12) /* Stuff to continue */
20:18:01 <esolangs> [[Hum]] https://esolangs.org/w/index.php?diff=149986&oldid=149095 * Ractangle * (-868) Redirected page to [[Jive]]
20:18:21 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=149987&oldid=149677 * Ractangle * (-10) /* Esolangs */
20:24:09 <esolangs> [[JAGL]] https://esolangs.org/w/index.php?diff=149988&oldid=144802 * Ractangle * (-110) /* Syntax */
20:25:45 <esolangs> [[JAGL]] https://esolangs.org/w/index.php?diff=149989&oldid=149988 * Ractangle * (+1) /* Hello, world! */
20:29:51 <esolangs> [[JAGL]] https://esolangs.org/w/index.php?diff=149990&oldid=149989 * Ractangle * (+0) /* Interpreter */
20:30:04 <esolangs> [[Special:Log/move]] move * Ractangle * moved [[JAGL]] to [[Just]]
20:31:44 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149993&oldid=149991 * Ractangle * (+39)
20:35:37 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:38:28 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149994&oldid=149993 * Ractangle * (+0) /* Interpreter */
20:39:10 -!- supercode has quit (Ping timeout: 240 seconds).
20:39:12 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=149995&oldid=149985 * Ractangle * (+0) /* Stuff to continue */
20:39:23 -!- supercode has joined.
20:40:24 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149996&oldid=149994 * Ractangle * (-99) /* Syntax */
20:40:48 -!- Everything has joined.
20:40:57 -!- ais523 has joined.
20:42:25 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149997&oldid=149996 * Ractangle * (+43)
20:43:21 -!- tromp has joined.
20:43:35 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149998&oldid=149997 * Ractangle * (+16) /* Syntax */
20:55:40 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=149999&oldid=149998 * Ractangle * (+16) /* Syntax */
20:56:24 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=150000&oldid=149999 * Ractangle * (+29) /* Examples */
21:13:03 -!- chiselfuse has quit (Remote host closed the connection).
21:14:23 -!- chiselfuse has joined.
21:20:54 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150001&oldid=143785 * Ractangle * (-14) /* Commands */
21:25:15 <esolangs> [[Special:Log/upload]] overwrite * Ractangle * uploaded a new version of "[[File: logo.png]]"
21:30:37 -!- supercode has quit (Quit: Client closed).
21:38:14 -!- DOS_User_webchat has joined.
21:41:35 -!- DOS_User_webchat has quit (Remote host closed the connection).
21:45:54 <esolangs> [[Blocked]] https://esolangs.org/w/index.php?diff=150003&oldid=145268 * Ractangle * (+4) Changed redirect target from [[User:Ractangle/Sandbox#Rating and people]] to [[User:Ractangle/Sandbox#Opinions about people]]
22:01:12 -!- __monty__ has quit (Quit: leaving).
22:05:22 <esolangs> [[Blocked]] https://esolangs.org/w/index.php?diff=150004&oldid=150003 * Ais523 * (+192) rv edit of a page about an esolang to redirect to a userspace page that isn't an esolang that isn't an appropriate use for mainspace
22:10:03 <esolangs> [[User talk:Ractangle]] https://esolangs.org/w/index.php?diff=150005&oldid=149348 * Ais523 * (+849) /* Please stop breaking mainspace links by moving pages */ new section
22:11:28 <ais523> oh no, this is going to be a huge mess to sort out
22:11:54 <ais523> https://esolangs.org/wiki/Special:Log?type=move&user=Ractangle for anyone who is wondering about the mess
22:16:32 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:55:28 <esolangs> [[Braine]] https://esolangs.org/w/index.php?diff=150006&oldid=68175 * Kaveh Yousefi * (+289) Rectified the memory description from the bit to the byte type, extended the instructions elucidation by the line numbering concept, and supplemented a page category tag.
22:55:44 -!- Everything has quit (Quit: leaving).
22:57:56 <esolangs> [[Braine]] https://esolangs.org/w/index.php?diff=150007&oldid=150006 * Kaveh Yousefi * (+491) Introduced an examples section comprehending one inicipial member, added a hyperlink to my implementation on GitHub, and supplemented the Implemented category tag.
23:03:20 -!- shmup has quit (Remote host closed the connection).
23:06:38 <esolangs> [[Pyline]] https://esolangs.org/w/index.php?diff=150008&oldid=149431 * Jan jelo * (+27) /* Quine */
23:29:17 <esolangs> [[BF Joust champions]] https://esolangs.org/w/index.php?diff=150009&oldid=149742 * Ais523 * (+180) /* 2009 */ make a modern-syntax version of jix_wiggle3 so that it can be tested against today's hills
23:32:06 <zemhill> web.Gregor_sucralose_philip: points -1.00, score 17.83, rank 24/47
23:32:29 <ais523> that one scores shockingly well for a program from 2011
23:37:32 <ais523> it seems to be primarily due to programs that simply can't deal with the opponent using a forward decoy setup
23:40:19 <zemhill> web.Lymia_nyuroki2: points 10.21, score 30.22, rank 6/47
23:40:58 <ais523> and that one is stronger than nyuroki3, which may have been overfitted
00:03:04 -!- mtm has quit (Ping timeout: 260 seconds).
00:05:33 -!- mtm has joined.
00:53:04 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150010&oldid=149944 * PrySigneToFry * (+845)
00:53:21 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150011&oldid=150010 * PrySigneToFry * (+0) Fixed time
00:56:53 -!- craigo has quit (Ping timeout: 248 seconds).
01:01:57 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=150012&oldid=149961 * PrySigneToFry * (+773)
01:08:27 <esolangs> [[Nope.]] M https://esolangs.org/w/index.php?diff=150013&oldid=148992 * PrySigneToFry * (+242)
01:12:39 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150014&oldid=149934 * PrySigneToFry * (+81)
01:16:38 <esolangs> [[Translated /tommyaweosme]] https://esolangs.org/w/index.php?diff=150015&oldid=149970 * PrySigneToFry * (+48)
01:25:19 <esolangs> [[Translated /PSTF Again3]] N https://esolangs.org/w/index.php?oldid=150016 * PrySigneToFry * (+1924) Created page with "[[Translated /tommyaweosme]] is not crazy enough, so let's be crazier!!!!!! 1. Drag out that scarred program <pre> - .kgm - .kgm 2016-2021 - ..."
01:42:15 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150017&oldid=149930 * PrySigneToFry * (+423)
01:48:20 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
01:53:14 <esolangs> [[User:ClearLimediWater]] https://esolangs.org/w/index.php?diff=150018&oldid=149956 * ClearLimediWater * (+27)
01:57:44 <esolangs> [[Luke's Box Programming]] https://esolangs.org/w/index.php?diff=150019&oldid=149957 * ClearLimediWater * (+110)
01:59:29 <esolangs> [[Luke's Box Pseudocode]] N https://esolangs.org/w/index.php?oldid=150020 * ClearLimediWater * (+753) Created page with "'''Luke's Box Pseudocode''' (abbreviated as LBP2) is an ''not very'' [[esoteric programming language]] made by [[User:ClearLimediWater]]. == Introduction == This is a simplified version of LBP1. == Examples == === [[Hello, world!]] === FUNC{
02:02:36 -!- moony has quit (Quit: leaving).
02:02:44 -!- iovoid has quit (Quit: iovoid has quit!).
02:02:44 -!- Bowserinator has quit (Read error: Connection reset by peer).
03:05:03 -!- op_4 has quit (Remote host closed the connection).
03:05:34 -!- op_4 has joined.
03:36:55 <esolangs> [[Luke's Box Pseudocode]] https://esolangs.org/w/index.php?diff=150021&oldid=150020 * ClearLimediWater * (-250) /* Hello, world! */
03:43:09 <esolangs> [[User talk:ClearLimediWater]] https://esolangs.org/w/index.php?diff=150022&oldid=149949 * ClearLimediWater * (+133)
03:43:17 -!- Bowserinator has joined.
03:44:12 <esolangs> [[User:Tommyaweosme/BRING BACK THE OLD SANDBOX]] https://esolangs.org/w/index.php?diff=150023&oldid=149442 * PrySigneToFry * (+14) fixed
03:45:11 -!- moony has joined.
03:47:04 -!- iovoid has joined.
04:20:55 -!- moony has quit (Quit: leaving).
04:20:59 -!- Bowserinator has quit (Quit: Blame iczero something happened).
04:20:59 -!- iovoid has quit (Quit: iovoid has quit!).
04:24:05 <esolangs> [[Luke's Box Programming]] M https://esolangs.org/w/index.php?diff=150024&oldid=150019 * ClearLimediWater * (-6) /* Commands */
04:26:00 -!- Bowserinator has joined.
04:27:55 -!- moony has joined.
04:29:38 -!- iovoid has joined.
06:10:14 <esolangs> [[Luke's Box Pseudocode]] https://esolangs.org/w/index.php?diff=150025&oldid=150021 * ClearLimediWater * (+33)
06:20:15 -!- Guest2 has joined.
06:20:48 -!- Guest2 has quit (Client Quit).
06:21:17 -!- Guest71 has joined.
06:21:29 -!- Guest71 has quit (Client Quit).
06:21:43 -!- Guest31 has joined.
06:23:59 -!- Guest31 has quit (Client Quit).
06:34:10 -!- tromp has joined.
06:34:36 -!- tromp has quit (Client Quit).
06:43:01 -!- ais523 has quit (Quit: quit).
07:00:14 <esolangs> [[User talk:Ractangle]] https://esolangs.org/w/index.php?diff=150026&oldid=150005 * Ractangle * (+172) /* Please stop breaking mainspace links by moving pages */
07:01:08 <esolangs> [[Blocked]] https://esolangs.org/w/index.php?diff=150027&oldid=150004 * Ractangle * (-178)
07:02:20 <esolangs> [[Blocked]] https://esolangs.org/w/index.php?diff=150028&oldid=150027 * Ractangle * (+7)
08:00:33 -!- tromp has joined.
08:36:53 <esolangs> [[Special:Log/newusers]] create * Vertical Tab 'N * New user account
08:37:42 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150029&oldid=149935 * Vertical Tab 'N * (+152)
08:40:35 <esolangs> [[User:Vertical tab 'N]] N https://esolangs.org/w/index.php?oldid=150030 * Vertical Tab 'N * (+1051) I temporarily stored this in another wiki's sandbox.
08:46:39 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
08:48:04 -!- __monty__ has joined.
08:55:07 -!- __monty__ has quit (Quit: leaving).
08:57:38 -!- tromp has joined.
09:00:52 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=150031&oldid=150000 * Ractangle * (-3)
09:29:03 <esolangs> [[Snakel/Compatibility methods]] https://esolangs.org/w/index.php?diff=150032&oldid=147836 * Ractangle * (+13) /* Ultium */
10:41:20 <esolangs> [[User:PrySigneToFry/Sandbox/Some useless code]] N https://esolangs.org/w/index.php?oldid=150033 * PrySigneToFry * (+1752) Created page with "= C/C++ = == Wouldn't it be better to just comment it out? == <pre> while(false) { // TODO } </pre> <pre> if(false) { // TODO } </pre> == It'll definitely execute == <pre> #include<iostream> --snip-- if(1 == 1) { if
10:41:55 <esolangs> [[User:PrySigneToFry/Sandbox]] https://esolangs.org/w/index.php?diff=150034&oldid=141723 * PrySigneToFry * (+95)
10:42:21 <esolangs> [[User:PrySigneToFry/Sandbox]] https://esolangs.org/w/index.php?diff=150035&oldid=150034 * PrySigneToFry * (-26)
10:47:14 <esolangs> [[Anti-Plushie language/PSTF]] https://esolangs.org/w/index.php?diff=150036&oldid=149461 * PrySigneToFry * (+37)
10:52:34 <esolangs> [[+]] https://esolangs.org/w/index.php?diff=150037&oldid=149460 * PrySigneToFry * (+158)
11:07:58 -!- supercode has joined.
11:32:05 -!- craigo has joined.
12:03:40 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:44 -!- mtm has joined.
12:22:22 <esolangs> [[Translated /tommyaweosme]] https://esolangs.org/w/index.php?diff=150038&oldid=150015 * I am islptng * (+49)
12:22:35 <esolangs> [[Translated /tommyaweosme]] https://esolangs.org/w/index.php?diff=150039&oldid=150038 * I am islptng * (-1)
12:24:05 <esolangs> [[Translated /PSTF Again3]] https://esolangs.org/w/index.php?diff=150040&oldid=150016 * I am islptng * (+87)
12:25:20 -!- Sgeo has quit (Read error: Connection reset by peer).
12:34:04 <esolangs> [[Translated /islptng Again 2]] N https://esolangs.org/w/index.php?oldid=150041 * I am islptng * (+1892) Created page with "1.Take that [[Translated /PSTF Again3|]]. Macintosh Macintosh ..."
12:49:25 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:04:56 <esolangs> [[User:I am islptng/Sandbox/Titin]] N https://esolangs.org/w/index.php?oldid=150042 * I am islptng * (+21166) Created page with "<pre> mttgaptftgplgsvvvluystatfuahisyfpvpuvsrfndygviststlpyvgisfsdynakltipavtkaqsynoslkatqysygatstaullvkautappqfvgnlgsmtvngysgvnlgvnvtyipqpvvkfondyauigssldfgisguydloslliauaopudsytosvqatqsvynatstaullvgyuuuvpakktktivstagisusngtniukkiuahfdansi
13:06:23 <esolangs> [[User:I am islptng/Sandbox/Titin]] https://esolangs.org/w/index.php?diff=150043&oldid=150042 * I am islptng * (+379)
13:19:28 -!- amby has joined.
13:32:16 <esolangs> [[Titin]] N https://esolangs.org/w/index.php?oldid=150044 * I am islptng * (+42147) Created page with "{{wrongtitle|title=Methionylthreonylthreonylalanylprolyl...leucylarginylthreonylserylvalylis}}<br> This is a trivial [[brainstack(islptng)|brainstack]] substitution. ==Syntax== Every program starts with the first 9999 letters of titin: methionylthreonylthreonylgl
13:33:35 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=150045&oldid=149865 * I am islptng * (+59)
14:02:49 -!- supercode has quit (Quit: Client closed).
14:05:42 -!- tromp has joined.
14:17:20 -!- __monty__ has joined.
14:26:57 <esolangs> [[Translated /islptng Again 2]] https://esolangs.org/w/index.php?diff=150046&oldid=150041 * MihaiEso * (+46)
14:42:01 -!- chomwitt_mobile has joined.
14:42:55 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150047&oldid=150014 * PrySigneToFry * (+301)
14:46:07 <esolangs> [[Translated /Mihai Again!]] N https://esolangs.org/w/index.php?oldid=150048 * MihaiEso * (+2718) Created page with "1.Take that [[Translated /islptng Again 2|]]. 75 De Feed Nutrition Tokuho 2. Mix well with 2500000 bags of instant noodles, 100000 liters of Coca-Cola, 100000..."
14:52:59 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150049&oldid=150047 * PrySigneToFry * (+1163)
14:57:00 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150050&oldid=150049 * PrySigneToFry * (+226)
15:02:06 -!- DOS_User_webchat has joined.
15:35:14 -!- DOS_User_webchat has quit (Remote host closed the connection).
15:37:42 <esolangs> [[Talk:Translated /Mihai Again!]] N https://esolangs.org/w/index.php?oldid=150051 * I am islptng * (+957) Created page with "<blockquote>100000 liters of liquid nitrogen at -999999999999 degrees Celsius</blockquote> Fun fact: Nitrogen at -273.15 degree Celsius (or below) is solid. Also, everybody actually can't freeze something to -273.16 degree Celsius. <blockquote
15:59:32 <esolangs> [[Talk:]] N https://esolangs.org/w/index.php?oldid=150052 * I am islptng * (+604) Created page with "How to use library Kitten4? By the way I'm still a fan of Kitten4. ~~~~"
16:09:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:10:02 -!- tromp has joined.
16:34:41 -!- ais523 has joined.
16:36:01 -!- DOS_User_webchat has joined.
16:36:16 -!- DOS_User_webchat has quit (Remote host closed the connection).
17:23:16 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=150053&oldid=150012 * Juanp32 * (+137)
17:32:13 <esolangs> [[Special:Log/move]] move * 47 * moved [[Titin]] to [[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]]
17:32:53 <esolangs> [[Special:Log/move]] move_redir * 47 * moved [[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]] to [[Titin]] over redirect: Revert
17:32:53 <esolangs> [[Special:Log/delete]] delete_redir * 47 * 47 deleted redirect [[Titin]] by overwriting: Deleted to make way for move from "[[Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreonylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycylserylthreonylalanylthreonylphenylalanylglutamylalanylh]]"
17:39:27 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=150058&oldid=150031 * 47 * (-32) /* Syntax */
17:39:34 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=150059&oldid=150058 * 47 * (-3) /* Cat program */
18:10:50 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:35:39 -!- tromp has joined.
18:36:46 -!- Lord_of_Life_ has joined.
18:37:15 -!- Lord_of_Life has quit (Ping timeout: 246 seconds).
18:38:24 -!- DOS_User_webchat has joined.
18:39:44 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:40:58 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:42:39 -!- FreeFull has quit.
18:42:43 -!- DOS_User_webchat has joined.
18:44:03 -!- FreeFull has joined.
18:46:12 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:54:34 -!- yewscion has joined.
19:03:01 -!- yewscion_ has joined.
19:05:25 -!- yewscion has quit (Ping timeout: 248 seconds).
19:44:52 -!- Sgeo has joined.
19:55:28 -!- DOS_User_webchat has joined.
20:06:07 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:07:45 -!- tromp has joined.
20:17:10 -!- DOS_User_webchat has quit (Ping timeout: 240 seconds).
20:20:40 -!- DOS_User_webchat has joined.
20:26:08 -!- DOS_User_webchat has quit (Remote host closed the connection).
20:43:42 -!- chomwitt_mobile has quit (Ping timeout: 252 seconds).
21:05:26 <esolangs> [[Special:Log/newusers]] create * FluixMakesEsolangs * New user account
21:07:11 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:08:57 <esolangs> [[Esolang:Introduce yourself]] M https://esolangs.org/w/index.php?diff=150060&oldid=150029 * FluixMakesEsolangs * (+129) /* Introductions */
21:10:00 -!- tromp has joined.
21:45:18 -!- yewscion_ has quit (Remote host closed the connection).
21:46:35 -!- yewscion has joined.
22:24:09 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:40:31 -!- __monty__ has quit (Quit: leaving).
23:20:47 -!- ais523 has quit (Ping timeout: 265 seconds).
23:29:44 <esolangs> [[User:Jan jelo/Lambda to SKI]] N https://esolangs.org/w/index.php?oldid=150061 * Jan jelo * (+1559) Created page with "This is a converter in Haskell converts lambda calculus into SKI combinators. <pre class="rectwrap"> main = do print $ convert $ omega -- ((s i) i) print $ convert $ turing -- (((s i) i) ((s (k (s i))) ((s ((s (k s)) ((s (k k)) ((s i) i)))) (k i
23:32:51 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150062&oldid=149583 * Jan jelo * (+33) /* Other */
23:45:06 -!- ais523 has joined.
23:49:07 <esolangs> [[Translated /Mihai Again!]] https://esolangs.org/w/index.php?diff=150063&oldid=150048 * I am islptng * (+12) fix
00:03:48 -!- mtm has quit (Ping timeout: 265 seconds).
00:07:05 -!- mtm has joined.
00:22:11 -!- voxpelli has joined.
00:29:54 <esolangs> [[User:XKCD Random Number]] M https://esolangs.org/w/index.php?diff=150064&oldid=147835 * Calculus is fun * (+90) Added MoreMathRPN example
00:39:00 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150065&oldid=149700 * PkmnQ * (+522) /* Examples */
00:39:03 -!- Sgeo has quit (Read error: Connection reset by peer).
00:39:24 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150066&oldid=150065 * PkmnQ * (+1) /* > */ Fish
00:41:06 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150067&oldid=150066 * PkmnQ * (+4) /* Fish */
00:42:28 -!- Sgeo has joined.
00:43:33 <esolangs> [[User:TheCanon2]] M https://esolangs.org/w/index.php?diff=150068&oldid=149848 * TheCanon2 * (+62)
00:59:51 <esolangs> [[Looping counter]] M https://esolangs.org/w/index.php?diff=150069&oldid=149215 * Calculus is fun * (+84) Added MoreMathRPN example
01:37:30 <esolangs> [[Mario Maker Calculator is not Turing-complete]] N https://esolangs.org/w/index.php?oldid=150070 * TheCanon2 * (+788) Created page with "In the video [https://www.youtube.com/watch?v=QyzNsOhshis| "We Built A Computer in Mario Maker!"], the Game Theorists describe a machine made in Mario Maker that uses logic gates to add two numbers from 0-7 and prints the result as
01:45:36 <esolangs> [[Luke's Box Programming]] M https://esolangs.org/w/index.php?diff=150071&oldid=150024 * ClearLimediWater * (+0) /* Commands */
01:45:51 <esolangs> [[Talk:Burn]] https://esolangs.org/w/index.php?diff=150072&oldid=147690 * BestCoder * (+102)
01:47:54 <esolangs> [[Luke's Box Programming]] M https://esolangs.org/w/index.php?diff=150073&oldid=150071 * ClearLimediWater * (+0) /* Commands */
01:48:48 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
01:55:20 <esolangs> [[Luke's Box Pseudocode]] https://esolangs.org/w/index.php?diff=150074&oldid=150025 * ClearLimediWater * (+386) /* Hello, world! */
01:59:27 <esolangs> [[Pi-alpha function]] M https://esolangs.org/w/index.php?diff=150075&oldid=135613 * Calculus is fun * (+526) Added MoreMathRPN example
02:00:04 <esolangs> [[Pi-alpha function]] M https://esolangs.org/w/index.php?diff=150076&oldid=150075 * Calculus is fun * (-3) /* MoreMathRPN */
02:00:47 <esolangs> [[Pi-alpha function]] M https://esolangs.org/w/index.php?diff=150077&oldid=150076 * Calculus is fun * (-2) /* MoreMathRPN */
02:09:23 <esolangs> [[Luke's Box Pseudocode]] https://esolangs.org/w/index.php?diff=150078&oldid=150074 * ClearLimediWater * (+129) /* A+B Problem */
02:09:59 <esolangs> [[Luke's Box Programming]] M https://esolangs.org/w/index.php?diff=150079&oldid=150073 * ClearLimediWater * (-1) /* Commands */
02:16:29 <esolangs> [[Luke's Box Pseudocode]] https://esolangs.org/w/index.php?diff=150080&oldid=150078 * ClearLimediWater * (+260) /* Truth-machine */
02:16:43 <esolangs> [[Mario Maker Calculator is not Turing-complete]] M https://esolangs.org/w/index.php?diff=150081&oldid=150070 * TheCanon2 * (+312)
02:41:31 <esolangs> [[FizzBuzz]] M https://esolangs.org/w/index.php?diff=150082&oldid=134890 * Calculus is fun * (+250) Added MoreMathRPN example
02:41:52 <esolangs> [[Luke's Box Pseudocode]] M https://esolangs.org/w/index.php?diff=150083&oldid=150080 * ClearLimediWater * (+45) /* Examples */
02:49:28 -!- ais523 has quit (Quit: quit).
03:19:22 <esolangs> [[Shape-Machine]] M https://esolangs.org/w/index.php?diff=150084&oldid=149470 * Calculus is fun * (+82) Added MoreMathRPN example
03:48:27 <esolangs> [[Never Gonna Give You Up]] M https://esolangs.org/w/index.php?diff=150085&oldid=145237 * Calculus is fun * (+1184) Added MoreMathRPN example
03:48:33 <esolangs> [[Mario Maker Calculator is not Turing-complete]] M https://esolangs.org/w/index.php?diff=150086&oldid=150081 * TheCanon2 * (+969) finished
04:22:11 -!- yewscion_ has joined.
04:22:35 -!- yewscion has quit (Read error: Connection reset by peer).
04:58:42 <esolangs> [[$3COND]] https://esolangs.org/w/index.php?diff=150087&oldid=103153 * BoundedBeans * (-1) Fix typo of "an"
05:07:59 <esolangs> [[Drive-In Window JSON]] https://esolangs.org/w/index.php?diff=150088&oldid=129924 * BoundedBeans * (+1) The backtick is reserved in namespaced IDs if it needs to be escaped
05:10:07 <esolangs> [[Drive-In Window JSON]] https://esolangs.org/w/index.php?diff=150089&oldid=150088 * BoundedBeans * (-41) Fix some reserved character stuff
05:57:22 -!- yewscion has joined.
05:58:05 -!- yewscion_ has quit (Read error: Connection reset by peer).
06:48:10 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=150090&oldid=150084 * Ractangle * (-1) /* Implementations */
07:00:29 -!- Sgeo has quit (Read error: Connection reset by peer).
07:58:18 -!- tromp has joined.
08:20:45 -!- chomwitt_mobile has joined.
08:32:26 <esolangs> [[Talk:Burn]] https://esolangs.org/w/index.php?diff=150091&oldid=150072 * Ractangle * (+204) /* UHH */
10:07:57 -!- __monty__ has joined.
10:25:27 <esolangs> [[Talk:Burn]] https://esolangs.org/w/index.php?diff=150092&oldid=150091 * PkmnQ * (+234)
11:21:56 <esolangs> [[CreativeASM]] https://esolangs.org/w/index.php?diff=150093&oldid=148709 * MihaiEso * (-191)
11:22:11 <esolangs> [[CreativeASM]] https://esolangs.org/w/index.php?diff=150094&oldid=150093 * MihaiEso * (-23)
11:25:20 <esolangs> [[CreativeASM/Assembler/Old Versions]] https://esolangs.org/w/index.php?diff=150095&oldid=136136 * MihaiEso * (+8)
11:57:06 <esolangs> [[CreativeASM/Examples]] https://esolangs.org/w/index.php?diff=150096&oldid=136138 * MihaiEso * (+5671)
11:58:11 <esolangs> [[Never Gonna Give You Up]] https://esolangs.org/w/index.php?diff=150097&oldid=150085 * MihaiEso * (+73)
11:59:39 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=150098&oldid=149932 * Buckets * (+12)
11:59:47 <esolangs> [[User talk:ClearLimediWater]] https://esolangs.org/w/index.php?diff=150099&oldid=150022 * ClearLimediWater * (+118)
12:01:20 <esolangs> [[Chops]] N https://esolangs.org/w/index.php?oldid=150100 * Buckets * (+2454) Created page with "Chops is an esoteric language where it's instructions are variable, dependent on the previous ASCII character created by [[User:Buckets]], created to fill the purpose of "What if I just made an esolang, so that It's hard enough to look like garbage, but easy to make a mac
12:03:33 -!- mtm has quit (Ping timeout: 248 seconds).
12:06:41 -!- mtm has joined.
12:42:43 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:46:32 -!- amby has joined.
13:50:22 -!- yewscion_ has joined.
13:53:12 -!- yewscion has quit (Ping timeout: 265 seconds).
14:36:29 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=150101&oldid=150069 * Jan jelo * (+203) /* Unlambda */
14:37:41 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=150102&oldid=150101 * Jan jelo * (-1) /* Unlambda */
14:44:37 <esolangs> [[Unlambda]] https://esolangs.org/w/index.php?diff=150103&oldid=147426 * Jan jelo * (+244) /* Examples */
14:52:16 -!- tromp has joined.
15:15:44 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=150104&oldid=149903 * Blashyrkh * (+238) /* Programs */
15:28:21 <esolangs> [[BytePusher]] https://esolangs.org/w/index.php?diff=150105&oldid=150104 * Blashyrkh * (-27) /* Programs */
15:30:43 -!- iovoid has quit (Ping timeout: 252 seconds).
15:30:43 -!- Bowserinator has quit (Ping timeout: 252 seconds).
15:30:50 -!- moony has quit (Ping timeout: 265 seconds).
15:43:36 -!- DOS_User_webchat has joined.
15:48:23 -!- moony has joined.
15:49:03 -!- Bowserinator has joined.
15:49:46 -!- DOS_User_webchat has quit (Remote host closed the connection).
15:50:06 -!- DOS_User_webchat has joined.
15:50:16 -!- iovoid has joined.
15:58:38 -!- molson has joined.
16:01:37 -!- DOS_User_webchat has quit (Remote host closed the connection).
16:01:55 -!- molson_ has quit (Ping timeout: 260 seconds).
16:35:35 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150106&oldid=147179 * Calculus is fun * (+431) Added MoreMathRPN example
16:56:09 -!- craigo has quit (Quit: Leaving).
16:57:03 -!- craigo has joined.
16:58:42 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150107&oldid=149926 * Calculus is fun * (+369) Added links of examples on other pages
17:22:00 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150108&oldid=150082 * Blashyrkh * (+2263) /* Examples */ FizzBuzz implementation in Lazy K
17:48:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:13:31 -!- tromp has joined.
18:23:24 <esolangs> [[Curse]] M https://esolangs.org/w/index.php?diff=150109&oldid=69669 * Jan jelo * (+28) /* Bijective Pair Function */
18:37:50 -!- Lord_of_Life_ has joined.
18:37:53 -!- Lord_of_Life has quit (Ping timeout: 265 seconds).
18:39:12 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:48:02 <esolangs> [[2025]] https://esolangs.org/w/index.php?diff=150110&oldid=130286 * 47 * (+0) /* Interpreter */
18:51:17 <esolangs> [[Shape-Machine]] M https://esolangs.org/w/index.php?diff=150111&oldid=150090 * Calculus is fun * (+0) /* External resources */
19:32:30 <esolangs> [[Half hearted]] N https://esolangs.org/w/index.php?oldid=150112 * Calculus is fun * (+1050) Added Half hearted program form
20:16:54 -!- chomwitt_mobile has quit (Ping timeout: 244 seconds).
20:22:46 -!- Everything has joined.
22:07:25 <esolangs> [[AGG]] https://esolangs.org/w/index.php?diff=150113&oldid=122949 * Mmph * (+81)
22:09:28 <esolangs> [[AGG]] M https://esolangs.org/w/index.php?diff=150114&oldid=150113 * Mmph * (+32)
22:10:42 <esolangs> [[User:Brain Boy 53]] M https://esolangs.org/w/index.php?diff=150115&oldid=130540 * Brain Boy 53 * (+27)
22:14:11 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:18:40 -!- tromp has joined.
22:20:14 <esolangs> [[NoError]] https://esolangs.org/w/index.php?diff=150116&oldid=132109 * Brain Boy 53 * (+1)
22:27:36 <esolangs> [[Malbolge Reborn]] https://esolangs.org/w/index.php?diff=150117&oldid=131441 * Brain Boy 53 * (+18)
22:36:05 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:52:47 <esolangs> [[Malbolge Reborn]] M https://esolangs.org/w/index.php?diff=150118&oldid=150117 * Brain Boy 53 * (+36)
23:04:47 <esolangs> [[Special:Log/newusers]] create * WinslowJosiah * New user account
23:13:06 -!- Sgeo has joined.
23:51:46 -!- __monty__ has quit (Quit: leaving).
00:02:58 -!- mtm has quit (Ping timeout: 248 seconds).
00:06:11 -!- mtm has joined.
00:28:26 -!- DOS_User_webchat has joined.
00:29:11 -!- DOS_User_webchat has quit (Remote host closed the connection).
01:34:28 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
01:42:44 -!- Bowserinator has quit (Ping timeout: 260 seconds).
01:42:54 -!- iovoid has quit (Ping timeout: 260 seconds).
02:00:22 -!- Bowserinator has joined.
02:00:28 -!- iovoid has joined.
02:20:51 -!- craigo has quit (Quit: Leaving).
02:28:24 -!- craigo has joined.
02:39:47 -!- craigo has quit (Quit: Leaving).
02:47:55 -!- craigo has joined.
03:10:01 -!- Sgeo has quit (*.net *.split).
03:10:02 -!- op_4 has quit (*.net *.split).
03:10:02 -!- fowl has quit (*.net *.split).
03:10:02 -!- Hooloovoo has quit (*.net *.split).
03:10:04 -!- lynndotpy6 has quit (*.net *.split).
03:10:04 -!- Noisytoot has quit (*.net *.split).
03:10:04 -!- sprout has quit (*.net *.split).
03:15:01 -!- Sgeo has joined.
03:15:01 -!- op_4 has joined.
03:15:01 -!- fowl has joined.
03:15:01 -!- Hooloovoo has joined.
03:15:01 -!- lynndotpy6 has joined.
03:15:01 -!- Noisytoot has joined.
03:15:01 -!- sprout has joined.
03:16:50 -!- craigo has quit (Quit: Leaving).
03:27:33 -!- Everything has quit (Ping timeout: 252 seconds).
04:11:08 <esolangs> [[Underload/a interpreter in scheme]] N https://esolangs.org/w/index.php?oldid=150119 * Jan jelo * (+2102) Created page with "This is a [[Underload]] interpreter in scheme by [[User:Jan jelo]]. <pre> (define(init program) (list(string->list program) '())) (define(program state) (list-ref state 0)) (define(stack state) (list-ref state 1)) ;a (define(a state)
04:13:11 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150120&oldid=150062 * Jan jelo * (+39) /* Intepreters */
04:38:53 <esolangs> [[PDAsephtwo]] N https://esolangs.org/w/index.php?oldid=150121 * BoundedBeans * (+16102) Created page with "PDAseptwo is an extension of [[PDAsephone]] by [[User:BoundedBeans]], made in January 2025. ==Storage== PDAsephone normally has two stacks, a stack of characters and a stack of instances of [[push-down automata]]. Each push-down automaton has a stack of charac
04:39:40 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150122&oldid=150098 * BoundedBeans * (+17)
04:41:01 <esolangs> [[User:BoundedBeans]] https://esolangs.org/w/index.php?diff=150123&oldid=148989 * BoundedBeans * (+108)
04:41:10 <esolangs> [[Underload/a interpreter in scheme]] https://esolangs.org/w/index.php?diff=150124&oldid=150119 * Jan jelo * (+1)
04:48:03 <esolangs> [[User:BoundedBeans/My Funge-98 fingerprints]] https://esolangs.org/w/index.php?diff=150125&oldid=127692 * BoundedBeans * (+0) Wrong fingerprint name
04:54:22 <esolangs> [[User:BoundedBeans/My Funge-98 fingerprints]] https://esolangs.org/w/index.php?diff=150126&oldid=150125 * BoundedBeans * (+162) Additional operations to GRPH
04:55:53 <esolangs> [[User:BoundedBeans/My Funge-98 fingerprints]] https://esolangs.org/w/index.php?diff=150127&oldid=150126 * BoundedBeans * (+55) Hyperbolic functions in GRPH
05:12:01 <esolangs> [[Testeee]] N https://esolangs.org/w/index.php?oldid=150128 * BestCoder * (+176) Created page with "<span style="transform: perspective(400px) rotateY(308deg) scale(2,1); text-shadow: 3px 3px 4px #0008; display: inline-block; padding-right: 3em;">hello i am really cool</span>"
05:12:14 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150129&oldid=150128 * BestCoder * (+1)
05:12:24 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150130&oldid=150129 * BestCoder * (-2)
05:12:36 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150131&oldid=150130 * BestCoder * (+0)
05:12:46 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150132&oldid=150131 * BestCoder * (+0)
05:12:56 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150133&oldid=150132 * BestCoder * (+0)
05:13:05 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150134&oldid=150133 * BestCoder * (+0)
05:13:14 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150135&oldid=150134 * BestCoder * (+0)
05:13:23 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150136&oldid=150135 * BestCoder * (+0)
05:13:54 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150137&oldid=150136 * BestCoder * (+0)
05:14:03 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150138&oldid=150137 * BestCoder * (+0)
05:14:21 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150139&oldid=150138 * BestCoder * (-2)
05:14:29 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150140&oldid=150139 * BestCoder * (+2)
05:14:39 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150141&oldid=150140 * BestCoder * (-2)
05:15:00 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150142&oldid=150141 * BestCoder * (+15)
05:15:18 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150143&oldid=150142 * BestCoder * (+16)
05:15:28 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150144&oldid=150143 * BestCoder * (+1)
05:15:40 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150145&oldid=150144 * BestCoder * (+2)
05:16:00 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150146&oldid=150145 * BestCoder * (+9)
05:16:36 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150147&oldid=150146 * BestCoder * (+41)
05:17:00 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150148&oldid=150147 * BestCoder * (+19)
05:17:14 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150149&oldid=150148 * BestCoder * (+0)
05:17:34 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150150&oldid=150149 * BestCoder * (+12)
05:17:44 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150151&oldid=150150 * BestCoder * (+2)
05:18:11 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150152&oldid=150151 * BestCoder * (+23)
05:18:23 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150153&oldid=150152 * BestCoder * (-2)
05:18:41 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150154&oldid=150153 * BestCoder * (+16)
05:18:54 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150155&oldid=150154 * BestCoder * (+77)
05:19:16 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150156&oldid=150155 * BestCoder * (+336)
05:20:39 <esolangs> [[Talk:Burn]] https://esolangs.org/w/index.php?diff=150157&oldid=150092 * BestCoder * (+30) /* UHH */
05:22:35 <esolangs> [[Tictactoe]] https://esolangs.org/w/index.php?diff=150158&oldid=149441 * BestCoder * (-9)
05:24:51 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150159&oldid=150156 * BestCoder * (+99)
05:25:05 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150160&oldid=150159 * BestCoder * (+8)
05:25:37 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150161&oldid=150160 * BestCoder * (+1)
05:26:04 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150162&oldid=150161 * BestCoder * (+428)
05:26:18 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150163&oldid=150162 * BestCoder * (-536)
05:26:31 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150164&oldid=150163 * BestCoder * (-40)
05:26:39 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150165&oldid=150164 * BestCoder * (-22)
05:26:55 <esolangs> [[Testeee]] https://esolangs.org/w/index.php?diff=150166&oldid=150165 * BestCoder * (-217)
07:13:00 <esolangs> [[Special:Log/delete]] delete * Ais523 * deleted "[[Testeee]]": offtopic (not an esolang)
07:17:09 -!- tromp has joined.
08:25:08 -!- Sgeo has quit (Read error: Connection reset by peer).
09:28:36 -!- m5zs7k has quit (Ping timeout: 246 seconds).
09:30:39 <esolangs> [[Special:Log/newusers]] create * Piet; * New user account
09:36:18 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150167&oldid=150060 * Piet; * (+158)
09:46:57 -!- m5zs7k has joined.
09:51:04 -!- __monty__ has joined.
11:12:56 <esolangs> [[Translated /Mihai Again!]] https://esolangs.org/w/index.php?diff=150168&oldid=150063 * MihaiEso * (+164)
11:27:28 -!- amby has joined.
12:02:29 -!- mtm has quit (Ping timeout: 248 seconds).
12:05:31 -!- mtm has joined.
12:17:59 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:24:16 -!- chomwitt_mobile has joined.
12:26:06 -!- __monty__ has quit (Quit: leaving).
12:28:17 -!- __monty__ has joined.
12:29:00 <esolangs> [[Beunfunge]] N https://esolangs.org/w/index.php?oldid=150169 * None1 * (+265) Created page with "'''Beunfunge''' is an esolang invented by [[User:None1]]. It is [[Befunge]], but there's no self modifying. ==Examples== Many examples in Befunge work in Beunfunge too, but some do not. [[Category:Two-dimensional languages]] [[Category:Languages]] [[Category:2025]]"
12:43:04 <esolangs> [[User:Thalassohora]] https://esolangs.org/w/index.php?diff=150170&oldid=115547 * Thalassohora * (-134)
12:47:36 -!- chomwitt_mobile has quit (Remote host closed the connection).
13:09:44 <esolangs> [[Pyline Classic]] https://esolangs.org/w/index.php?diff=150171&oldid=149330 * Jan jelo * (+1251) /* Examples */
13:10:14 <esolangs> [[Pyline Classic]] M https://esolangs.org/w/index.php?diff=150172&oldid=150171 * Jan jelo * (+2)
13:23:03 -!- impomatic has joined.
13:50:30 -!- tromp has joined.
13:56:33 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150173&oldid=148099 * I am islptng * (+580) /* desmos */ new section
13:57:25 -!- wib_jonas has joined.
13:57:41 <HackEso> olist <https://www.giantitp.com/comics/oots1317.html>: shachaf oerjan Sgeo boily nortti b_jonas Noisytoot
13:57:43 <wib_jonas> I think that might be my fastest olist yet
14:35:49 <impomatic> Does anyone know an algorithm to calculate the nash equilibrium percentage of a big matrix? The kind of equilibrium where the matrix contains scores of something in the row vs something in the column, and the equilibrium is x% percent of the first row, y% of the second row, z% of the third row, etc, which gives everything exactly the same score.
14:36:32 -!- tromp has quit (Read error: Connection reset by peer).
14:37:25 <impomatic> Google is just showing me how to find the equilibrium in 2x2 matrices, so I'm wondering if what I'm looking for has another name.
15:03:44 -!- wib_jonas has quit (Quit: Client closed).
15:21:15 -!- wib_jonas has joined.
15:23:30 -!- fowl has quit (Quit: Ping timeout (120 seconds)).
15:24:02 -!- fowl has joined.
15:40:24 -!- chomwitt has joined.
15:40:30 -!- chomwitt_alt has joined.
15:42:52 <int-e> impomatic: If it's a zero sum game, there's a linear programming formulation for that; https://en.wikipedia.org/wiki/Zero-sum_game#Solving ... otherwise it'http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
15:43:31 <int-e> ...otherwise it's something called PPAD-complete that I have not yet understood, http://www.maths.lse.ac.uk/Personal/stengel/chendeng2nash.pdf
15:43:53 <int-e> (gotta love fat-fingering '-<RET> )
15:45:36 <int-e> impomatic: in any case that's what I guess your question was, so hopefully that's good for some alternative keywords.
15:48:01 <int-e> Beautiful. Firefox is blocking http links returned by https://html.duckduckgo.com/html/ because they are a "Potential security risk".
15:55:12 -!- impomatic has quit (Quit: Client closed).
15:55:38 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150174&oldid=150173 * Ractangle * (+200) /* desmos */
16:05:45 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150175&oldid=150174 * I am islptng * (+645)
16:20:40 -!- wib_jonas has quit (Ping timeout: 240 seconds).
16:44:58 -!- craigo has joined.
16:58:40 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150176&oldid=150175 * Jan jelo * (+202) /* desmos */
17:13:54 <korvo> PPAD-complete is more-or-less FNP-complete, FWIW; we haven't proven it yet, but there's piles of evidence and my prior is at something like 97%.
17:14:30 <korvo> IOW free markets probably are not efficient; there are probably cases where a free market can't avoid sitting exponentially far from Nash equilibrium for exponentially long.
17:15:22 <int-e> you mean on top of all the other things that are obviously going wrong with that theory?
17:15:29 <int-e> (rational agents, lol)
17:15:53 <korvo> Of course, yeah. (Personally I'm still waiting for a categorical formulation of markets; absent one, I'm not convinced that they have a nice algebraic theory.)
17:18:56 <int-e> korvo: what exactly is FNP? f(x) = y can be verified in polynomial time?
17:19:10 <int-e> (I can look it up if the answer is no)
17:19:35 <int-e> (I guess I could look it up regardless :-P)
17:19:54 <korvo> int-e: I think there's a couple equivalent formulations. I think of it as a generalization of ♯NP; it's like NP but all problems are valued in nats instead of Booleans.
17:21:32 <korvo> But we can take any countable domain, I think, so that we can have functions M -> {R} from markets to computable sets of computable reals. And that would formalize Nash equilibria, given a formalization of markets.
17:21:55 <int-e> hah, of course "FNP class" does not eliminate the "family nurse practitioner" false positive ;) ("complexity" did the trick)
17:23:14 <korvo> In this case, the part that's quick to verify is a function R × M -> 2 which checks that a particular market valuation is Nash by checking that each market participant doesn't have any better options; the part that's expensive is computing the history of the market's evolution.
17:24:06 <int-e> Hmm not sure I see the #NP (model counting) connection.
17:25:40 <korvo> Nash equilibria aren't unique; there's multiple possible histories which converge.
17:26:38 <int-e> I mean, FNP doesn't count.
17:26:57 <korvo> Oh, sure. It's more general than that.
17:27:37 <korvo> I mean, yes, I'm wrong; I'm just saying that I think of function problems as generalized counting of decision problems.
17:27:50 <int-e> I guess you can ask how many solutions there are and then it becomes #NP, more or less.
17:43:51 <b_jonas> https://complexityzoo.net/Complexity_Zoo:F#fnp doesn't seem to say that there's such a thing as FNP-completeness
17:51:58 <korvo> Aaronson omits many things, but yeah, it could well be the case that there's no such notion of completeness under reductions.
17:52:43 <b_jonas> do you know what kind of reduction this needs?
17:52:52 <korvo> Note that there's no such notion of PPAD-completeness either. It happens to be the case that the problem of finding Nash equilibria is complete for PPAD, but I'm not sure if there's a nice category PPADC of such problems or if Nash is a special case.
17:53:14 <b_jonas> different reductions can result in different notions of completness I think
17:53:39 <b_jonas> but maybe it's obvious in this case
17:53:39 <korvo> I imagine it's the same sort of reduction as in NP-completeness: a computable poly-time rewrite of the input problem. I'd guess that we also need a contravariant computable poly-time adapter for the output, so that we can transform the outputs from one problem to another too.
17:54:05 <korvo> Oh, yes, for sure. For example the category NPC is specifically about computable poly-time reductions.
17:56:40 <b_jonas> and like sometimes you want to allow multiple calls to an oracle
17:57:47 <int-e> korvo: you might have to poly-time manipulate the output too?
17:59:52 <b_jonas> ooh, this may be relevant: https://complexityzoo.net/Complexity_Zoo_References#dgp05
18:01:14 <b_jonas> C. Daskalakis, P. W. Goldberg, and C. H. Papadimitriou "The Complexity of Computing a Nash Equilibrium", SIAM J. Comput. 39(1):195-259, 2009. doi:10.1137/070699652 Originally appeared in STOC 2006, Author's website conference version "https://people.csail.mit.edu/costis/simplified.pdf" .
18:02:43 <int-e> yeah the PDF I linked above is a follow-up for that work (well, an earlier technical report version of it)
18:03:25 <korvo> int-e: Yeah. Like, imagine each function problem is a general arrow I -> O in some category. To transform it to X -> Y, we need both X -> I and also O -> Y, with the latter contravariant. This doesn't matter for NPC because everything is X -> 2 there.
18:08:47 -!- impomatic has joined.
18:09:56 -!- impomatic has quit (Client Quit).
18:30:04 -!- DOS_User_webchat has joined.
18:31:20 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:38:20 -!- Lord_of_Life_ has joined.
18:39:32 -!- Lord_of_Life has quit (Ping timeout: 272 seconds).
18:40:57 -!- impomatic has joined.
18:41:15 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:50:27 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150177&oldid=150108 * Jan jelo * (+947) /* Examples */
18:54:53 <esolangs> [[Muriel]] https://esolangs.org/w/index.php?diff=150178&oldid=149501 * Jan jelo * (+955) /* Examples */
18:55:54 <esolangs> [[Muriel]] M https://esolangs.org/w/index.php?diff=150179&oldid=150178 * Jan jelo * (+4) /* 99 bottles of beer */
18:56:37 <esolangs> [[Muriel]] M https://esolangs.org/w/index.php?diff=150180&oldid=150179 * Jan jelo * (+5) /* Hello, world! */
19:27:43 <esolangs> [[Just]] https://esolangs.org/w/index.php?diff=150181&oldid=150059 * 47 * (-12)
20:13:35 -!- int-e has quit (Remote host closed the connection).
20:14:13 -!- int-e has joined.
20:14:50 -!- lambdabot has quit (Remote host closed the connection).
20:16:27 -!- lambdabot has joined.
20:19:06 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150182&oldid=149983 * Ractangle * (+437) /* Syntax */
20:20:11 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150183&oldid=150182 * Ractangle * (+0) the r is lowercase
20:24:21 -!- chomwitt_alt has quit (Ping timeout: 248 seconds).
20:24:21 -!- chomwitt has quit (Ping timeout: 248 seconds).
20:31:02 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150184&oldid=150183 * Ractangle * (+7) /* The IMP */
20:47:25 -!- ais523 has joined.
21:03:07 <esolangs> [[FizzBuzz]] M https://esolangs.org/w/index.php?diff=150185&oldid=150177 * Jan jelo * (-6) /* Muriel */
21:04:35 <esolangs> [[Muriel]] M https://esolangs.org/w/index.php?diff=150186&oldid=150180 * Jan jelo * (-5) /* FizzBuzz */
21:07:27 <esolangs> [[Muriel/compile from minsky machine]] M https://esolangs.org/w/index.php?diff=150187&oldid=149232 * Jan jelo * (+4)
21:17:08 <esolangs> [[Underload/a interpreter in scheme]] M https://esolangs.org/w/index.php?diff=150188&oldid=150124 * Jan jelo * (+212)
21:30:44 <esolangs> [[NumbersPlusWhat]] N https://esolangs.org/w/index.php?oldid=150189 * FluixMakesEsolangs * (+1133) Initial version of this page
21:31:22 <esolangs> [[NumbersPlusWhat]] M https://esolangs.org/w/index.php?diff=150190&oldid=150189 * FluixMakesEsolangs * (+6) Fixed grammer error
21:31:53 <esolangs> [[NumbersPlusWhat]] https://esolangs.org/w/index.php?diff=150191&oldid=150190 * FluixMakesEsolangs * (-96)
21:32:40 <esolangs> [[NumbersPlusWhat]] M https://esolangs.org/w/index.php?diff=150192&oldid=150191 * FluixMakesEsolangs * (+34) fixed some stuff
22:23:39 <esolangs> [[Beunfunge]] M https://esolangs.org/w/index.php?diff=150193&oldid=150169 * Aadenboy * (+9) stub
22:32:34 -!- lisbeths has joined.
22:49:00 -!- Sgeo has joined.
23:09:29 -!- fowl0 has joined.
23:09:55 -!- fowl has quit (Read error: Connection reset by peer).
23:09:56 -!- fowl0 has changed nick to fowl.
23:34:34 -!- __monty__ has quit (Quit: leaving).
00:03:30 -!- ais523 has quit (Ping timeout: 265 seconds).
00:03:36 -!- mtm has quit (Ping timeout: 252 seconds).
00:04:20 -!- impomatic has quit (Quit: Client closed).
00:05:10 -!- mtm has joined.
00:13:00 -!- ais523 has joined.
00:51:50 -!- lisbeths has quit (Quit: Connection closed for inactivity).
02:21:30 -!- ais523 has quit (Quit: quit).
02:22:49 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:05:38 -!- Sgeo has quit (Read error: Connection reset by peer).
03:08:31 -!- Sgeo has joined.
03:08:50 -!- Noisytoot has quit (Quit: ZNC 1.9.1 - https://znc.in).
03:09:59 -!- Noisytoot has joined.
03:17:25 -!- Noisytoot has quit (Remote host closed the connection).
03:17:56 -!- Noisytoot has joined.
03:22:52 -!- Noisytoot has quit (Remote host closed the connection).
03:40:17 -!- Noisytoot has joined.
06:28:13 <esolangs> [[BitTurn]] N https://esolangs.org/w/index.php?oldid=150194 * I am islptng * (+477) Created page with "<b>BitTurn</b> is an esolang that operates on a 2D bitmap. The pointer can read/write the bits on the map and move. ==Commands== {|class=wikitable ! Command !! Meaning |- | <code><nowiki>|</nowiki></code> || Flip the current bit pointing and move forward. |- | <cod
07:08:08 -!- JAA has quit (Quit: leaving).
07:09:15 -!- JAA has joined.
07:12:32 -!- b_jonas has quit (Quit: leaving).
07:42:16 <esolangs> [[Esolang:Categorization]] https://esolangs.org/w/index.php?diff=150195&oldid=146885 * 47 * (-67)
07:45:58 <esolangs> [[BIX Queue Subset]] https://esolangs.org/w/index.php?diff=150196&oldid=132672 * 47 * (+22) /* See also */
07:48:13 <esolangs> [[Brainmaker]] https://esolangs.org/w/index.php?diff=150197&oldid=73046 * 47 * (+23) /* Interpreters */
07:51:38 <esolangs> [[Number factory]] https://esolangs.org/w/index.php?diff=150198&oldid=130968 * Piet; * (+49)
07:52:13 <esolangs> [[Number Factory]] https://esolangs.org/w/index.php?diff=150199&oldid=71656 * Piet; * (+49)
08:06:05 -!- Sgeo has quit (Read error: Connection reset by peer).
08:44:36 -!- craigo has quit (Remote host closed the connection).
09:43:58 <esolangs> [[StackedDeck]] N https://esolangs.org/w/index.php?oldid=150200 * Ashli Katt * (+6746) Create page for StackedDeck, specification incomplete temporarily.
09:51:48 <esolangs> [[StackedDeck]] M https://esolangs.org/w/index.php?diff=150201&oldid=150200 * Ashli Katt * (-1) /* Execution */
09:59:49 <esolangs> [[StackedDeck]] M https://esolangs.org/w/index.php?diff=150202&oldid=150201 * Ashli Katt * (+0) /* Card Execution */
10:20:25 -!- __monty__ has joined.
11:45:49 <esolangs> [[Talk:Translated /Mihai Again!]] https://esolangs.org/w/index.php?diff=150203&oldid=150051 * PrySigneToFry * (+1244)
11:55:07 -!- chomwitt_alt has joined.
11:55:07 -!- chomwitt has joined.
11:59:17 <esolangs> [[Translated /PSTF Again4]] N https://esolangs.org/w/index.php?oldid=150204 * PrySigneToFry * (+2130) Created page with "1. Take that [[Translated /Mihai Again!|]]. <pre> ** ** ** ** ** ..."
12:00:33 <esolangs> [[Translated /Mihai Again!]] https://esolangs.org/w/index.php?diff=150205&oldid=150168 * PrySigneToFry * (+64)
12:03:11 -!- mtm has quit (Ping timeout: 265 seconds).
12:05:30 <HackEso> password The password of the month is not from a jedi.
12:06:21 -!- mtm has joined.
12:19:38 -!- FreeFull has quit (Quit: Lost terminal).
13:44:02 <esolangs> [[User:Gilbert189/Iternary]] https://esolangs.org/w/index.php?diff=150206&oldid=140378 * Gilbert189 * (+1658)
13:44:20 <esolangs> [[User:Gilbert189/A way to golf Baba is You esolangs]] https://esolangs.org/w/index.php?diff=150207&oldid=129056 * Gilbert189 * (+20) added WRITE and BOOM
14:29:36 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150208&oldid=149016 * Unname4798 * (+160)
14:29:59 <esolangs> [[User:Unname4798]] M https://esolangs.org/w/index.php?diff=150209&oldid=150208 * Unname4798 * (+7)
14:30:15 <esolangs> [[User:Unname4798]] M https://esolangs.org/w/index.php?diff=150210&oldid=150209 * Unname4798 * (+0)
14:36:23 -!- ais523 has joined.
14:48:57 -!- impomatic has joined.
15:05:37 <esolangs> [[FizzBuzz]] M https://esolangs.org/w/index.php?diff=150211&oldid=150185 * Jan jelo * (+29) /* TeX */
15:08:00 -!- amby has joined.
15:17:40 -!- impomatic has quit (Ping timeout: 240 seconds).
15:38:35 -!- chomwitt_alt has quit (Ping timeout: 252 seconds).
15:38:35 -!- chomwitt has quit (Ping timeout: 252 seconds).
15:44:59 -!- DOS_User_webchat has joined.
15:47:37 -!- DOS_User_webchat has quit (Remote host closed the connection).
15:47:54 -!- DOS_User_webchat has joined.
16:02:58 -!- DOS_User_webchat has quit (Remote host closed the connection).
16:45:28 <esolangs> [[Thue]] https://esolangs.org/w/index.php?diff=150212&oldid=142604 * Jan jelo * (+469) /* Sample programs */
16:46:06 <esolangs> [[Thue]] M https://esolangs.org/w/index.php?diff=150213&oldid=150212 * Jan jelo * (+1) /* Sample programs */
16:53:36 <esolangs> [[++===]] N https://esolangs.org/w/index.php?oldid=150214 * PkmnQ * (+1414) Created page with "[[++===]] is a register-based [[OISC]] with no branching. The name is a concatenation of <code>++</code>, <code>==</code>, and <code>=</code>, describing the singular instruction (<code>if (*A<u>++</u> <u>==</u> *B) *A <u>=</u> *C;</code>). == Specification == Memory in [[
17:04:10 <esolangs> [[Thue]] M https://esolangs.org/w/index.php?diff=150215&oldid=150213 * Jan jelo * (+0) /* Sample programs */
17:44:30 -!- craigo has joined.
17:50:37 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150216&oldid=150167 * WinslowJosiah * (+141)
17:51:11 <esolangs> [[Bespoke]] N https://esolangs.org/w/index.php?oldid=150217 * WinslowJosiah * (+10960) Created page with "'''Bespoke''' is an [[esoteric programming language]] created in 2025 by Josiah Winslow. It encodes instructions into the lengths of words, similarly to his earlier esolang [[Poetic (esolang)|Poetic]]. Programs can tend to look like abstract poetry, although a se
18:07:54 -!- b_jonas has joined.
18:18:12 <b_jonas> you know how in Windows, if you want to enter a unicode code point of which you know the code, you can open either WordPad or Word, enter the number in hexadecimal, then press alt+X, right? Now I was told that some future version of Windows might not include WordPad by default. Sounds bad, right? How will you enter arbitrary code points without installing additional software. Nope, actually TIL that
18:18:18 <b_jonas> Windows 11's version of Notepad supports this too, so no need to use Wordpad for this on Windows 11 machines.
18:20:14 -!- iovoid has quit (*.net *.split).
18:20:14 -!- Bowserinator has quit (*.net *.split).
18:20:15 -!- Artea has quit (*.net *.split).
18:20:16 -!- MizMahem has quit (*.net *.split).
18:20:17 -!- myname has quit (*.net *.split).
18:22:24 -!- iovoid has joined.
18:22:24 -!- Bowserinator has joined.
18:22:24 -!- Artea has joined.
18:22:24 -!- MizMahem has joined.
18:22:24 -!- myname has joined.
18:22:27 -!- Artea has quit (Max SendQ exceeded).
18:35:21 -!- chomwitt_alt has joined.
18:35:21 -!- chomwitt has joined.
18:38:56 -!- Lord_of_Life_ has joined.
18:39:27 -!- Lord_of_Life has quit (Ping timeout: 244 seconds).
18:41:53 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:43:37 -!- Artea has joined.
19:05:26 -!- FreeFull has joined.
19:12:08 <esolangs> [[User:Aadenboy/Ultimate warsides]] N https://esolangs.org/w/index.php?oldid=150218 * Aadenboy * (+6081) ULTIMATE WARSIDES.
19:18:09 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=150219&oldid=149919 * Aadenboy * (+38) add [[User:Aadenboy/Ultimate warsides]]
20:10:00 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150220&oldid=150184 * Ractangle * (+0) /* The IMP */
20:27:33 -!- chomwitt_alt has quit (Ping timeout: 248 seconds).
20:27:33 -!- chomwitt has quit (Ping timeout: 248 seconds).
21:22:14 -!- tromp has joined.
21:59:02 -!- mtm_ has joined.
22:00:50 -!- mtm has quit (Ping timeout: 248 seconds).
22:32:09 -!- zzo38 has quit (Ping timeout: 246 seconds).
22:38:41 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150221&oldid=150211 * Jan jelo * (+2494) /* Thue */
22:39:47 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:44:07 -!- zzo38 has joined.
22:56:33 <esolangs> [[User:Jan jelo/FizzBuzz in Thue]] N https://esolangs.org/w/index.php?oldid=150222 * Jan jelo * (+2569) Created page with "This is a [[FizzBuzz]] program in [[Thue]] by [[User: Jan jelo]]. Outputs are separated by <code>;</code>. <pre> o0::=~0 o1::=~1 o2::=~2 o3::=~3 o4::=~4 o5::=~5 o6::=~6 o7::=~7 o8::=~8 o9::=~9 0[<0]::=0[3>] 1[<0]::=[<1]1 2[<0]::=2[3>] 3[<0]::=3[
23:07:18 -!- __monty__ has quit (Quit: leaving).
23:09:06 -!- Sgeo has joined.
23:12:04 <korvo> The podcast "Future of Coding" is updating again! Their recent episode is about whether the universe is a computer. https://futureofcoding.org/episodes/074
23:17:11 -!- molson_ has joined.
23:21:09 -!- molson has quit (Ping timeout: 276 seconds).
23:34:16 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150223&oldid=150120 * Jan jelo * (+36) /* Other */
23:56:05 -!- ming__ has joined.
23:58:51 -!- yewscion_ has quit (Ping timeout: 276 seconds).
00:02:45 -!- mtm_ has quit (Ping timeout: 276 seconds).
00:06:18 -!- mtm has joined.
01:50:01 -!- Sgeo has quit (Read error: Connection reset by peer).
01:59:31 -!- ming__ has quit (Quit: Leaving).
01:59:52 -!- ming__ has joined.
02:00:01 -!- ming__ has quit (Remote host closed the connection).
02:00:54 -!- yewscion has joined.
02:04:39 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:44:06 -!- Sgeo has joined.
03:16:20 -!- Sgeo has quit (Read error: Connection reset by peer).
03:20:43 -!- Sgeo has joined.
03:39:14 <esolangs> [[Trajedy]] https://esolangs.org/w/index.php?diff=150224&oldid=52419 * Jafetish * (+5) /* Implementation */ update URL
04:09:34 <esolangs> [[User:XKCD Random Number]] https://esolangs.org/w/index.php?diff=150225&oldid=150064 * Piet; * (+271) /* Bespoke */
04:12:21 -!- m5zs7k has quit (Ping timeout: 276 seconds).
04:17:07 -!- m5zs7k has joined.
04:33:51 <esolangs> [[++===]] https://esolangs.org/w/index.php?diff=150226&oldid=150214 * PkmnQ * (+88) /* Specification */
04:44:28 -!- ais523 has quit (Ping timeout: 244 seconds).
05:29:50 -!- Sgeo has quit (Read error: Connection reset by peer).
06:06:45 -!- FreeFull has quit.
06:24:49 -!- craigo has quit (Read error: Connection reset by peer).
06:25:07 -!- craigo has joined.
06:32:13 -!- Sgeo has joined.
06:36:36 -!- Sgeo has quit (Read error: Connection reset by peer).
06:57:29 -!- Sgeo has joined.
06:59:36 -!- Sgeo_ has joined.
07:03:22 -!- Sgeo has quit (Ping timeout: 265 seconds).
07:32:40 -!- Sgeo_ has quit (Read error: Connection reset by peer).
07:35:08 -!- chomwitt_alt has joined.
07:35:09 -!- chomwitt has joined.
07:35:19 -!- ProofTechnique_ has quit (*.net *.split).
07:40:37 -!- ProofTechnique_ has joined.
07:51:46 -!- tromp has joined.
08:26:16 -!- chomwitt_alt has quit (Remote host closed the connection).
08:26:16 -!- chomwitt has quit (Remote host closed the connection).
09:02:30 -!- craigo has quit (Ping timeout: 246 seconds).
09:19:35 <esolangs> [[Print("Hello, World!")]] https://esolangs.org/w/index.php?diff=150227&oldid=148535 * Piet; * (+95) /* Python */
09:27:38 <esolangs> [[Print("Hello, World!")]] M https://esolangs.org/w/index.php?diff=150228&oldid=150227 * Piet; * (+7)
10:22:48 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:24:43 -!- __monty__ has joined.
10:26:58 -!- tromp has joined.
10:28:49 -!- V has quit (Remote host closed the connection).
10:29:15 -!- V has joined.
11:39:54 <esolangs> [[Beunfunge]] https://esolangs.org/w/index.php?diff=150229&oldid=150193 * None1 * (+123)
11:42:46 <esolangs> [[Cardinal]] https://esolangs.org/w/index.php?diff=150230&oldid=62320 * Piet; * (+25134) /* Rule 110 */ Possibly Turing-complete
11:44:27 <esolangs> [[Translated /PSTF Again4]] https://esolangs.org/w/index.php?diff=150231&oldid=150204 * PrySigneToFry * (+417)
11:47:10 <esolangs> [[Talk:Cardinal]] N https://esolangs.org/w/index.php?oldid=150232 * Piet; * (+230) Proof of Turing-completeness
11:49:06 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150233&oldid=150011 * Piet; * (+214) /* Is Cardinal Turing-complete? */ new section
11:53:19 <esolangs> [[Translated /PSTF Again4]] https://esolangs.org/w/index.php?diff=150234&oldid=150231 * PrySigneToFry * (+986)
11:58:46 <esolangs> [[Talk:]] https://esolangs.org/w/index.php?diff=150235&oldid=150052 * PrySigneToFry * (+374)
12:02:25 <esolangs> [[PrySigneToFry-complete]] https://esolangs.org/w/index.php?diff=150236&oldid=149883 * PrySigneToFry * (+385)
12:04:21 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:44 -!- mtm has joined.
12:28:43 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:16:16 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150237&oldid=150122 * None1 * (+16) /* B */
13:21:20 -!- m5zs7k has quit (Ping timeout: 265 seconds).
13:35:05 -!- m5zs7k has joined.
13:40:02 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=150238&oldid=149712 * None1 * (+51) /* My Esolangs */
13:52:03 -!- amby has joined.
13:55:52 -!- tromp has joined.
14:53:37 -!- Sgeo has joined.
15:04:07 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
15:08:32 -!- tromp has joined.
15:16:36 -!- FreeFull has joined.
15:44:05 -!- Sgeo has quit (Read error: Connection reset by peer).
15:55:18 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:04:35 -!- Sgeo has joined.
16:18:59 -!- impomatic has joined.
16:21:06 -!- tromp has joined.
17:12:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:13:24 -!- tromp has joined.
17:37:03 -!- ais523 has joined.
17:38:26 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:46:58 -!- Sgeo has quit (Read error: Connection reset by peer).
18:04:05 <esolangs> [[Special:Log/newusers]] create * Shannarra * New user account
18:08:06 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150239&oldid=150216 * Shannarra * (+125) /* Introductions */
18:09:30 -!- Sgeo has joined.
18:11:11 -!- tromp has joined.
18:15:10 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150240&oldid=150237 * Shannarra * (+15) /* S */
18:33:29 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150241&oldid=150221 * Blashyrkh * (+2420) /* Lazy K */ Another (a bit shorter) version of FizzBuzz written in Lazy K
18:36:13 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150242&oldid=150241 * Blashyrkh * (+9) /* Lazy K */
18:37:38 <esolangs> [[Sapphire]] N https://esolangs.org/w/index.php?oldid=150243 * Shannarra * (+1545) Sapphire - Ruby's evil twin language.
18:38:01 <esolangs> [[Sapphire]] https://esolangs.org/w/index.php?diff=150244&oldid=150243 * Shannarra * (-5)
18:40:00 -!- Lord_of_Life_ has joined.
18:40:45 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:41:20 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:56:45 <esolangs> [[Church numeral]] M https://esolangs.org/w/index.php?diff=150245&oldid=149108 * Jan jelo * (+0) /* Arithmetic */
19:15:56 -!- yewscion has quit (Ping timeout: 252 seconds).
19:23:09 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:23:28 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150246&oldid=150240 * WinslowJosiah * (+14) Add Bespoke
19:26:08 <esolangs> [[Hello world program in esoteric languages (B-C)]] https://esolangs.org/w/index.php?diff=150247&oldid=148318 * WinslowJosiah * (+378) Add Hello World in Bespoke
19:36:27 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=150248&oldid=150102 * Jan jelo * (+162) /* Examples */
19:40:12 <esolangs> [[Talk:Binary lambda calculus]] https://esolangs.org/w/index.php?diff=150249&oldid=139532 * Blashyrkh * (+262) /* Merely an encoding */
20:00:08 <esolangs> [[Talk:Binary lambda calculus]] https://esolangs.org/w/index.php?diff=150250&oldid=150249 * Blashyrkh * (+10) /* Merely an encoding */
20:47:20 <esolangs> [[Propositio]] M https://esolangs.org/w/index.php?diff=150251&oldid=147380 * * (+2) Fixed syntax
21:01:19 <esolangs> [[Closuretalk]] M https://esolangs.org/w/index.php?diff=150252&oldid=149203 * Rdococ * (-100) /* Conclusion */
21:04:19 <esolangs> [[Talk:Binary lambda calculus]] https://esolangs.org/w/index.php?diff=150253&oldid=150250 * Ais523 * (+491) /* Merely an encoding */ a matter of perspective
21:18:32 -!- yewscion has joined.
21:31:42 <esolangs> [[CContains]] N https://esolangs.org/w/index.php?oldid=150254 * * (+848) Started page
21:31:51 <esolangs> [[MarkupL]] https://esolangs.org/w/index.php?diff=150255&oldid=148127 * Ractangle * (-21) /* Syntax */
21:35:43 <esolangs> [[MarkupL]] https://esolangs.org/w/index.php?diff=150256&oldid=150255 * Ractangle * (-148) /* Cat program */
21:36:30 <esolangs> [[MarkupL]] https://esolangs.org/w/index.php?diff=150257&oldid=150256 * Ractangle * (-4) /* Cat program */
21:38:12 <esolangs> [[MarkupL]] https://esolangs.org/w/index.php?diff=150258&oldid=150257 * Ractangle * (-92)
21:41:13 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=150259&oldid=149995 * Ractangle * (-16) /* Stuff to continue */
21:41:41 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=150260&oldid=149987 * Ractangle * (+16) /* Esolangs */
21:43:31 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150261&oldid=149860 * Ractangle * (+62) /* Commands */
21:44:32 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150262&oldid=150261 * Ractangle * (+34) /* Truth-machine */
21:44:55 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150263&oldid=150262 * Ractangle * (-1) /* Truth-machine */
21:45:16 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150264&oldid=150263 * Ractangle * (-1) /* Commands */
21:46:50 -!- tromp has joined.
21:48:40 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150265&oldid=150264 * Ractangle * (-75) /* Commands */
21:50:21 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150266&oldid=150265 * Ractangle * (-32) /* Infinite Loop */
21:51:42 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150267&oldid=150266 * Ractangle * (+1) /* Infinite Loop */
22:02:46 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150268&oldid=150267 * Ractangle * (+259) /* Examples */
22:03:16 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150269&oldid=150268 * Ractangle * (+3) /* Hello world */
22:07:47 <esolangs> [[Postrado]] https://esolangs.org/w/index.php?diff=150270&oldid=150269 * Ractangle * (+2) /* Truth-machine */
22:10:43 -!- impomatic has quit (Quit: Client closed).
22:22:53 <esolangs> [[User:Calculus is fun]] M https://esolangs.org/w/index.php?diff=150271&oldid=149882 * Calculus is fun * (+20) Added People Category
22:26:09 <esolangs> [[Talk:///]] https://esolangs.org/w/index.php?diff=150272&oldid=149244 * Jan jelo * (+298)
22:30:41 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:30:51 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150273&oldid=150107 * Calculus is fun * (+43) /* Examples elsewhere on this site */
22:34:54 -!- craigo has joined.
22:40:11 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=150274&oldid=150219 * Aadenboy * (+21) zzzzzzzz whatever people category jumpscare
23:10:30 <esolangs> [[User:FluixMakesEsolangs]] N https://esolangs.org/w/index.php?oldid=150275 * FluixMakesEsolangs * (+143) Initial version of this page
23:14:40 -!- __monty__ has quit (Quit: leaving).
23:41:04 -!- Sgeo has quit (Read error: Connection reset by peer).
23:53:26 -!- Sgeo has joined.
23:54:27 -!- mtm_ has joined.
23:54:56 -!- mtm has quit (Read error: Connection reset by peer).
00:38:33 <esolangs> [[Talk:///]] https://esolangs.org/w/index.php?diff=150276&oldid=150272 * Jan jelo * (-298)
02:25:30 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:02:10 -!- Sgeo has quit (Read error: Connection reset by peer).
03:24:42 -!- ais523 has quit (Ping timeout: 252 seconds).
03:35:16 -!- Sgeo has joined.
03:36:10 -!- ais523 has joined.
04:09:37 <esolangs> [[Translated /PSTF Again4]] https://esolangs.org/w/index.php?diff=150277&oldid=150234 * PrySigneToFry * (+31)
04:23:31 <esolangs> [[StackedDeck]] https://esolangs.org/w/index.php?diff=150278&oldid=150202 * Ashli Katt * (+529) Describe the Discard Pile and Sleeve
04:54:59 <esolangs> [[StackedDeck]] M https://esolangs.org/w/index.php?diff=150279&oldid=150278 * Ashli Katt * (+611) Fill in some card effects
05:21:13 -!- Sgeo has quit (Read error: Connection reset by peer).
05:43:28 -!- Sgeo has joined.
05:57:08 -!- Sgeo has quit (Read error: Connection reset by peer).
06:03:07 -!- Sgeo has joined.
06:36:23 -!- Sgeo has quit (Read error: Connection reset by peer).
06:38:59 -!- Sgeo has joined.
06:45:12 -!- Sgeo has quit (Read error: Connection reset by peer).
06:49:32 <esolangs> [[]] N https://esolangs.org/w/index.php?oldid=150280 * None1 * (+1294) Created page with " is an esolang invented by [[User:None1]] that uses Chinese characters, what a Chinese character does depends on the radical of it. It has a stack that stores unbounded signed integers ==Commands== {| class="wikitable" ! Radical !! Meaning !! Example of Chinese characters |- |
06:50:09 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150281&oldid=150246 * None1 * (+13) /* Non-alphabetic */
06:50:37 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=150282&oldid=150238 * None1 * (+53) /* My Esolangs */
07:14:28 -!- tromp has joined.
07:23:19 <esolangs> [[Cardinal]] M https://esolangs.org/w/index.php?diff=150283&oldid=150230 * Piet; * (+9) Link
08:16:16 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
08:24:29 -!- ais523 has quit (Quit: quit).
08:45:41 -!- Melvar has quit (Ping timeout: 248 seconds).
08:46:29 -!- Noisytoot has quit (Read error: Connection reset by peer).
08:47:25 -!- Noisytoot has joined.
09:21:57 -!- tromp has joined.
09:39:37 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=150284&oldid=149387 * Jan jelo * (+1035) /* Tracing the ~ replacement code */
09:40:06 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=150285&oldid=150284 * Jan jelo * (+86) /* Tracing the ~ replacement code */
09:55:10 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150286&oldid=150067 * PkmnQ * (+288) /* FALSE */
10:00:31 <esolangs> [[AsciiDots]] https://esolangs.org/w/index.php?diff=150287&oldid=133992 * Piet; * (+2550) This page has been marked as Turing complete for a long time without an explicit proof.
10:14:02 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:28:03 <esolangs> [[FlipJump]] M https://esolangs.org/w/index.php?diff=150288&oldid=120354 * Tomhe * (+129) /* External resources */ Add c2fj and bf2fj
10:28:19 <esolangs> [[FlipJump]] M https://esolangs.org/w/index.php?diff=150289&oldid=150288 * Tomhe * (-3) /* External resources */
10:33:05 <esolangs> [[Special:Log/upload]] upload * Tomhe * uploaded "[[File:Prime sieve.gif]]"
10:37:35 <esolangs> [[FlipJump]] M https://esolangs.org/w/index.php?diff=150291&oldid=150289 * Tomhe * (+1068) Add c2fj, add flipjump primes_sieve
10:40:36 -!- tromp has joined.
10:45:34 <esolangs> [['Python' is not recognized]] https://esolangs.org/w/index.php?diff=150292&oldid=145151 * Ractangle * (+22) /* Syntax */
10:45:49 <esolangs> [['Python' is not recognized]] https://esolangs.org/w/index.php?diff=150293&oldid=150292 * Ractangle * (-1) /* Truth-machine */
11:56:01 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
11:56:12 -!- m5zs7k has quit (Ping timeout: 252 seconds).
11:59:08 -!- m5zs7k has joined.
12:00:03 -!- __monty__ has joined.
12:08:30 <esolangs> [[X-script]] N https://esolangs.org/w/index.php?oldid=150294 * PrySigneToFry * (+7705) Created page with "X-script is designed by PSTF. = Language Overview = X-Script is a Turing-complete, efficient, lightweight and concise programming language. It combines the simplicity of Python, the power of JavaScript, the "hacking" of assembly language, and the efficiency of C
12:21:23 -!- Melvar has joined.
12:45:34 <esolangs> [['Python' is not recognized]] https://esolangs.org/w/index.php?diff=150295&oldid=150293 * Ractangle * (-2) /* Truth-machine */
13:36:11 <esolangs> [[Talk:Underload]] https://esolangs.org/w/index.php?diff=150296&oldid=150285 * Jan jelo * (+770) /* Tracing the ~ replacement code */
13:45:42 -!- Sgeo has joined.
13:50:03 <esolangs> [[AsciiDots]] https://esolangs.org/w/index.php?diff=150297&oldid=150287 * Piet; * (-366) Shorter without exponent bug - I suddenly got a message about an IP-ban that has actually been expired, so I have to borrow my friend's computer
14:48:30 <esolangs> [[CContains]] https://esolangs.org/w/index.php?diff=150298&oldid=150254 * * (+373) Linked to self and added commands
14:49:47 <esolangs> [[User talk:]] https://esolangs.org/w/index.php?diff=150299&oldid=147382 * * (+18)
14:57:22 -!- craigo has quit (Ping timeout: 248 seconds).
15:19:29 -!- amby has joined.
15:32:29 <esolangs> [[User talk:]] https://esolangs.org/w/index.php?diff=150300&oldid=150299 * * (-347) Removed ULTRAESOLANG (i've given up)
15:46:05 <esolangs> [[Special:Log/newusers]] create * H33T33 * New user account
16:24:03 -!- impomatic has joined.
17:13:40 -!- impomatic has quit (Ping timeout: 240 seconds).
17:42:02 -!- DOS_User_webchat has joined.
17:51:38 -!- DOS_User_webchat has quit (Remote host closed the connection).
17:56:43 -!- DOS_User_webchat has joined.
18:02:38 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:04:05 -!- DOS_User_webchat has joined.
18:20:57 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:41:09 -!- Lord_of_Life has quit (Ping timeout: 265 seconds).
18:41:59 -!- Lord_of_Life has joined.
18:42:27 -!- amby has quit (Remote host closed the connection).
18:42:29 -!- tromp has joined.
18:53:40 -!- impomatic has joined.
19:03:59 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=150301&oldid=150281 * Buckets * (+12)
19:04:26 <esolangs> [[Sipes]] N https://esolangs.org/w/index.php?oldid=150302 * Buckets * (+867) Created page with "Sipes is an esoteric language found in an old Notebook created by [[User:Buckets]] in 2019, [[User:Buckets]] has Completely forgotton the Instructions and Commands, The only Insight was It wad created April 13th 2019, A note saying 'The interpretir can be 33 toothpicks,
19:05:49 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150303&oldid=150302 * Buckets * (+1)
19:09:26 <esolangs> [[Bespoke]] https://esolangs.org/w/index.php?diff=150304&oldid=150217 * WinslowJosiah * (+0) Fix error with H STOREVALUE docs
19:11:25 <esolangs> [[User:Buckets]] N https://esolangs.org/w/index.php?oldid=150305 * Buckets * (+41) Created page with "The Creator of *[[Chops]] and *[[Sipes]]."
20:00:49 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150306&oldid=150220 * 47 * (+291) /* Syntax */
20:05:02 <esolangs> [[CContains]] https://esolangs.org/w/index.php?diff=150307&oldid=150298 * * (+1508) Added Container Code segment and a few more commands.
20:06:53 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150308&oldid=150306 * 47 * (+378)
20:30:38 -!- impomatic has quit (Quit: Client closed).
20:41:02 <b_jonas> we must remember to choose some phrase related to Terry Pratchett to use as the password for 2025-03.
21:30:26 -!- Everything has joined.
22:14:10 <esolangs> [[Talk:]] N https://esolangs.org/w/index.php?oldid=150309 * Aadenboy * (+361) Created page with "this reminds me of my esolang, [[Kawa]], with the character radical aspect ~~~~"
22:15:44 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150310&oldid=150280 * Aadenboy * (+4) /* XKCD Random Number */ shouldn't there be a zero on the stack first?
22:42:04 <zzo38> What are the query parameters for pagination in GitHub and what are the parameters for sending a new issue and a comment of a issue?
22:58:24 -!- Sgeo has quit (Read error: Connection reset by peer).
23:05:52 -!- amby has joined.
23:12:25 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:33:57 -!- __monty__ has quit (Quit: leaving).
23:40:47 -!- Everything has quit (Quit: leaving).
23:41:00 -!- Noisytoot has quit (Quit: ZNC 1.9.1 - https://znc.in).
23:41:23 -!- Noisytoot has joined.
00:02:47 -!- Noisytoot has quit (Quit: ZNC 1.9.1 - https://znc.in).
00:03:46 -!- Noisytoot has joined.
00:18:55 <esolangs> [[StackedDeck]] M https://esolangs.org/w/index.php?diff=150311&oldid=150279 * Ashli Katt * (+72) Clarify discard pile order
00:26:14 -!- SGautam has joined.
00:42:38 -!- Sgeo has joined.
00:55:41 -!- Sgeo has quit (Read error: Connection reset by peer).
01:02:06 -!- craigo has joined.
01:25:35 -!- Sgeo has joined.
01:27:44 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150312&oldid=150310 * PrySigneToFry * (+42)
01:30:01 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150313&oldid=150301 * PrySigneToFry * (+15) /* X */
01:32:13 -!- V has quit (Remote host closed the connection).
01:32:39 -!- V has joined.
01:34:24 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150314&oldid=150312 * PrySigneToFry * (+895)
01:42:54 -!- V has quit (Remote host closed the connection).
01:43:21 -!- V has joined.
01:44:19 -!- V has quit (Remote host closed the connection).
01:44:45 -!- V has joined.
01:48:57 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150315&oldid=150294 * PrySigneToFry * (+505)
01:50:38 <esolangs> [[Translated SLet]] https://esolangs.org/w/index.php?diff=150316&oldid=146568 * PrySigneToFry * (+9)
02:27:56 -!- V has quit (Remote host closed the connection).
02:28:24 -!- V has joined.
02:29:14 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:48:06 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150317&oldid=150314 * YufangTSTSU * (-8) i sink belongs to
02:51:23 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150318&oldid=150315 * PrySigneToFry * (+1218)
03:01:39 <esolangs> [[User:Jan jelo/BF interpreter in Thue]] N https://esolangs.org/w/index.php?oldid=150319 * Jan jelo * (+4668) Created page with "This is a [[Brainfuck]] interpreter in [[Thue]] by [[User:Jan jelo]] (input and output are unary numbers(each output wrapped by <code>(</code> and <code>)</code>),the value of each cell is an unbounded natural number) <pre> {0>}+::=+{0>} {
03:05:07 <esolangs> [[Thue]] https://esolangs.org/w/index.php?diff=150320&oldid=150215 * Jan jelo * (+43) /* External resources */
03:25:36 -!- SGautam has quit (Quit: Connection closed for inactivity).
03:36:27 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150321&oldid=149942 * PrySigneToFry * (+1110) /* Make it even scarier !!!! */ new section
03:37:48 <esolangs> [[Bespoke]] https://esolangs.org/w/index.php?diff=150322&oldid=150304 * WinslowJosiah * (+141) Update instructions list to reflect CONTROL OTHERWISE
03:38:50 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150323&oldid=150321 * PrySigneToFry * (+107)
03:40:40 -!- Sgeo has quit (Read error: Connection reset by peer).
03:49:18 <esolangs> [[Hello world program in esoteric languages (nonalphabetic and A)]] https://esolangs.org/w/index.php?diff=150324&oldid=144394 * PrySigneToFry * (+272) /* */
03:55:11 -!- V has quit (Remote host closed the connection).
03:55:40 -!- V has joined.
03:56:14 -!- V has quit (Remote host closed the connection).
03:56:40 -!- V has joined.
03:56:46 -!- V has quit (Remote host closed the connection).
03:57:52 -!- V has joined.
03:57:55 -!- V has quit (Remote host closed the connection).
03:59:12 -!- V has joined.
04:13:39 -!- Sgeo has joined.
04:31:23 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticSwap.png]]": Ring
04:31:41 <esolangs> [[Kawa]] https://esolangs.org/w/index.php?diff=150326&oldid=149864 * Aadenboy * (+135) new command
04:59:13 -!- V has quit (Remote host closed the connection).
05:00:31 -!- V has joined.
05:14:53 <esolangs> [[(-)]] N https://esolangs.org/w/index.php?oldid=150327 * Yayimhere2(school) * (+1000) Created page with "{{wrongtitle|title=<->}} '''<->''' is an esolang about swapping text == syntax == an expression is evaluated right from left * -"''x''""''y''" swaps the order of string x and string y * <"''x''" delete the < and return an expression where its "''x''""''x''" so fo
05:16:16 <esolangs> [[(-)]] https://esolangs.org/w/index.php?diff=150328&oldid=150327 * Yayimhere2(school) * (+90)
05:18:23 -!- V has quit (Remote host closed the connection).
05:19:02 <esolangs> [[(-)]] https://esolangs.org/w/index.php?diff=150329&oldid=150328 * Yayimhere2(school) * (+17) /* syntax */
05:19:39 -!- V has joined.
05:32:35 <esolangs> [[Funciton]] M https://esolangs.org/w/index.php?diff=150330&oldid=141686 * Timwi * (+21)
06:10:22 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150331&oldid=150317 * YufangTSTSU * (+493)
06:20:44 <esolangs> [[Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;]] N https://esolangs.org/w/index.php?oldid=150332 * Yayimhere2(school) * (+289) Created page with "this makes no sense and also isn't Turing complete cuz its impossible to run the brainfuck code on the website. its also uncomputable cuz access isn't described well enough @~~~~"
06:52:30 -!- yayimhere has joined.
06:56:12 <yayimhere> i had this idea. we're the commands only are "unlocked" by using other commands. like where you need to use commands and then it unlocks a new command and so on. but is this really possible and could this be made interesting?
07:03:09 <korvo> Sure. For example, in Python, the command `math.sin()` is "unlocked" by `import math`.
07:12:43 <yayimhere> true(though its not interesting or really a gimmick)
07:17:19 <korvo> There are systems called "spellservers". In a spellserver, the way to "unlock" a command is with a cryptographic key or something else that's similarly hard to get.
07:17:47 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150333&oldid=150331 * YufangTSTSU * (+280)
07:17:53 <korvo> Brian Warner's writeup is still great; he describes what are known as Warner-style spellservers: https://www.lothar.com/blog/58-The-Spellserver/
07:22:37 <korvo> Is that really all you care about?
07:23:05 -!- V has quit (Remote host closed the connection).
07:24:00 <yayimhere> ive had comments that my esolangs are unoriginal
07:24:20 <yayimhere> so im trying to make smth that unique
07:24:22 -!- V has joined.
07:24:29 -!- V has quit (Remote host closed the connection).
07:25:46 -!- V has joined.
07:27:28 <korvo> Well, yeah. Nothing's really unique or original, right? Everything we make is built from prior designs.
07:28:16 <yayimhere> but at least make smth slightly unique
07:28:16 <korvo> You know those stories about Mozart or other child geniuses? They're usually exaggerated. Here's one common exaggeration: Mozart didn't actually write any of the melodies that he's credited with as a child.
07:29:06 <korvo> No, really. Or, in English, we have the legend of Shakespeare. But Shakespeare didn't actually write any of the plots to his stories; he borrowed them from other stories.
07:29:17 <korvo> (Or much more recently, Disney.)
07:29:51 <yayimhere> this reminds me of that one doctor who book series
07:31:05 <yayimhere> anywayn that gave me an idea/concept
07:31:30 <yayimhere> a esolang where the programs kinda steal contents from each other
07:31:33 -!- V has quit (Remote host closed the connection).
07:31:50 <yayimhere> then another could steal that result
07:31:57 <yayimhere> but you don't have control over it
07:32:49 -!- V has joined.
07:33:01 <korvo> FWIW actually *building* a spellserver is non-trivial. Note that Warner doesn't actually give one, nor explain its details; he just says that if somebody implements a language like E, then they could probably try to write a spellserver too.
07:33:13 <yayimhere> is there anything like this? or slightly like it(this is more to get insperation, and help cuz I have no idea how to do it))
07:33:36 -!- V has quit (Remote host closed the connection).
07:34:07 <korvo> https://github.com/monte-language/typhon/blob/master/mast/tools/spellserver.mt.md Anyway, I implemented a language like E, and then I wrote a spellserver.
07:34:28 <korvo> yayimhere: This is why int-e and I push you to learn to code; actually *implementing the idea* is what is hard and impressive. Anybody can have ideas.
07:34:53 -!- V has joined.
07:35:12 <korvo> Fun! I'm glad that you're learning.
07:35:31 <yayimhere> afterwards its minikanren and then lisp
07:35:56 -!- V has quit (Remote host closed the connection).
07:36:55 <yayimhere> my concentration is constantly stolen from v leaving and coming back to the server wow
07:37:11 -!- V has joined.
07:37:32 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150334&oldid=150333 * PrySigneToFry * (+217)
07:38:25 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150335&oldid=150334 * PrySigneToFry * (+29)
07:38:52 -!- yayimhere has quit (Quit: Client closed).
07:40:02 -!- V has quit (Remote host closed the connection).
07:41:18 -!- V has joined.
07:42:35 -!- V has quit (Remote host closed the connection).
07:43:52 -!- V has joined.
07:43:53 -!- V has quit (Remote host closed the connection).
07:45:12 -!- V has joined.
07:45:21 -!- V has quit (Remote host closed the connection).
07:46:37 -!- V has joined.
08:00:46 -!- tromp has joined.
08:01:58 -!- V has quit (Remote host closed the connection).
08:03:16 -!- V has joined.
08:03:25 -!- V has quit (Remote host closed the connection).
08:04:41 -!- V has joined.
08:04:41 -!- V has quit (Remote host closed the connection).
08:05:57 -!- V has joined.
08:06:43 -!- V has quit (Remote host closed the connection).
08:08:00 -!- V has joined.
08:08:02 -!- V has quit (Remote host closed the connection).
08:09:19 -!- V has joined.
08:09:22 -!- V has quit (Remote host closed the connection).
08:10:39 -!- V has joined.
08:10:39 -!- V has quit (Remote host closed the connection).
08:11:56 -!- V has joined.
08:12:02 -!- V has quit (Remote host closed the connection).
08:13:19 -!- V has joined.
08:14:21 -!- V has quit (Remote host closed the connection).
08:14:38 <esolangs> [[Talk:Semi-serious language list]] N https://esolangs.org/w/index.php?oldid=150336 * Yayimhere2(school) * (+205) Created page with "tbh this with the number of restraints should be called the "ultra serious" lang list... @~~~~"
08:15:37 -!- V has joined.
08:20:09 <esolangs> [[AsciiDots]] M https://esolangs.org/w/index.php?diff=150337&oldid=150297 * Piet; * (+68) Credits
08:26:28 -!- V has quit (Remote host closed the connection).
08:27:44 -!- V has joined.
08:27:53 -!- V has quit (Remote host closed the connection).
08:30:29 -!- V has joined.
08:31:09 -!- V has quit (Remote host closed the connection).
08:32:25 -!- V has joined.
08:33:17 -!- V has quit (Remote host closed the connection).
08:34:32 -!- V has joined.
08:35:34 <esolangs> [[Talk:AsciiDots]] https://esolangs.org/w/index.php?diff=150338&oldid=134806 * Piet; * (+303) Bug
08:36:15 -!- V has quit (Remote host closed the connection).
08:37:30 -!- V has joined.
08:38:40 -!- V has quit (Remote host closed the connection).
08:39:56 -!- V has joined.
08:40:49 -!- V has quit (Remote host closed the connection).
08:42:08 -!- V has joined.
08:43:08 -!- V has quit (Remote host closed the connection).
08:44:20 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
08:44:23 -!- V has joined.
08:44:51 -!- V has quit (Remote host closed the connection).
08:46:08 -!- V has joined.
08:48:51 -!- V has quit (Remote host closed the connection).
08:50:04 -!- Guest9464 has joined.
08:51:05 -!- Guest9464 has quit (Remote host closed the connection).
08:52:20 -!- V has joined.
08:52:32 -!- V has quit (Remote host closed the connection).
08:52:46 -!- tromp has joined.
08:54:06 -!- V has joined.
08:54:21 -!- V has quit (Remote host closed the connection).
08:55:37 -!- V has joined.
08:55:57 -!- V has quit (Remote host closed the connection).
08:57:14 -!- V has joined.
08:57:24 -!- V has quit (Remote host closed the connection).
08:58:40 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150339&oldid=150335 * YufangTSTSU * (+0) please check nop please check nop please check nop please check nop
08:58:40 -!- V has joined.
08:59:29 -!- V has quit (Remote host closed the connection).
09:00:45 -!- V has joined.
09:01:35 -!- V has quit (Remote host closed the connection).
09:02:52 -!- V has joined.
09:03:43 -!- V has quit (Remote host closed the connection).
09:05:04 -!- V has joined.
09:05:07 -!- V has quit (Remote host closed the connection).
09:06:23 -!- V has joined.
09:06:38 -!- V has quit (Remote host closed the connection).
09:07:53 -!- V has joined.
09:08:32 -!- V has quit (Remote host closed the connection).
09:09:48 -!- V has joined.
09:10:35 -!- V has quit (Remote host closed the connection).
09:11:51 -!- V has joined.
09:13:07 -!- V has quit (Remote host closed the connection).
09:14:22 -!- V has joined.
09:14:30 -!- V has quit (Remote host closed the connection).
09:15:46 -!- V has joined.
09:21:36 <esolangs> [[User:UrnEn/Sandbox]] M https://esolangs.org/w/index.php?diff=150340&oldid=148603 * UrnEn * (+6325)
09:29:33 -!- V has quit (Remote host closed the connection).
09:30:50 -!- V has joined.
09:30:57 -!- V has quit (Remote host closed the connection).
09:32:12 -!- V has joined.
09:32:16 -!- V has quit (Remote host closed the connection).
09:33:32 -!- V has joined.
09:35:15 -!- V has quit (Remote host closed the connection).
09:36:31 -!- V has joined.
09:44:54 -!- V has quit (Remote host closed the connection).
09:46:10 -!- V has joined.
09:46:10 -!- V has quit (Remote host closed the connection).
09:47:26 -!- V has joined.
09:47:27 -!- V has quit (Remote host closed the connection).
09:48:43 -!- V has joined.
09:49:41 -!- V has quit (Remote host closed the connection).
09:51:03 -!- V has joined.
09:51:04 -!- V has quit (Remote host closed the connection).
09:52:17 -!- Guest8686 has joined.
10:00:00 -!- Guest8686 has quit (Remote host closed the connection).
10:01:17 -!- V has joined.
10:01:28 -!- V has quit (Remote host closed the connection).
10:02:41 -!- Guest3889 has joined.
10:03:15 -!- Guest3889 has quit (Remote host closed the connection).
10:04:39 -!- V has joined.
10:04:43 -!- V has quit (Remote host closed the connection).
10:05:59 -!- V has joined.
10:06:03 -!- V has quit (Remote host closed the connection).
10:07:24 -!- V has joined.
10:07:25 -!- V has quit (Remote host closed the connection).
10:08:44 -!- V has joined.
10:09:54 -!- V has quit (Remote host closed the connection).
10:11:10 -!- V has joined.
10:11:56 -!- V has quit (Remote host closed the connection).
10:13:12 -!- V has joined.
10:13:19 -!- V has quit (Remote host closed the connection).
10:14:35 -!- V has joined.
10:14:41 -!- V has quit (Remote host closed the connection).
10:16:05 -!- V has joined.
10:16:34 -!- V has quit (Remote host closed the connection).
10:17:51 -!- V has joined.
10:17:58 -!- V has quit (Remote host closed the connection).
10:51:20 <esolangs> [[User talk:UrnEn]] N https://esolangs.org/w/index.php?oldid=150341 * Piet; * (+181) Heard this just now
11:14:57 -!- Sgeo has quit (Read error: Connection reset by peer).
11:23:27 <esolangs> [[Semi-serious language list]] https://esolangs.org/w/index.php?diff=150342&oldid=149826 * None1 * (+10) /* Non-alphabetic */
11:25:13 -!- __monty__ has joined.
12:08:49 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:14:11 -!- tromp has joined.
13:26:30 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:06:14 -!- tromp has joined.
14:20:37 -!- V has joined.
14:20:42 -!- V has quit (Remote host closed the connection).
14:23:24 -!- V has joined.
14:23:30 -!- V has quit (Remote host closed the connection).
14:24:53 -!- V has joined.
14:25:01 -!- V has quit (Remote host closed the connection).
14:26:22 -!- V has joined.
14:26:35 -!- V has quit (Remote host closed the connection).
14:30:31 -!- V has joined.
14:30:34 -!- V has quit (Remote host closed the connection).
14:31:12 -!- m5zs7k has quit (Ping timeout: 252 seconds).
14:32:31 -!- V has joined.
14:32:34 -!- V has quit (Remote host closed the connection).
14:33:53 -!- V has joined.
14:33:53 -!- V has quit (Remote host closed the connection).
14:35:15 -!- V has joined.
14:35:22 -!- V has quit (Remote host closed the connection).
14:35:47 -!- m5zs7k has joined.
14:36:47 -!- V has joined.
14:36:48 -!- V has quit (Remote host closed the connection).
14:38:06 -!- V has joined.
14:38:09 -!- V has quit (Remote host closed the connection).
14:42:40 -!- mtm has joined.
14:45:24 -!- mtm_ has quit (Ping timeout: 245 seconds).
14:51:49 -!- V has joined.
14:51:50 -!- V has quit (Remote host closed the connection).
15:31:43 -!- amby has joined.
15:54:11 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:22:34 -!- tromp has joined.
16:28:03 -!- V has joined.
16:28:25 -!- V has quit (Remote host closed the connection).
16:38:48 -!- impomatic has joined.
16:41:31 -!- impomatic has quit (Client Quit).
16:44:05 -!- impomatic has joined.
17:17:07 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:41:22 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150343&oldid=150286 * PkmnQ * (+317) /* Examples */ Add Binary lambda calculus
17:43:57 -!- tromp has joined.
17:52:16 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:00:30 -!- tromp has joined.
18:41:37 -!- Lord_of_Life has quit (Ping timeout: 252 seconds).
18:41:40 -!- Lord_of_Life_ has joined.
18:44:40 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
19:07:13 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=150344&oldid=150326 * Aadenboy * (+72) /* Example Programs */
19:08:05 -!- craigo has quit (Ping timeout: 248 seconds).
19:13:41 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaFibonacci.png]]": split into two lines, update to match newer changers
19:14:40 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaHelloWorld.png]]": split into three lines
19:16:44 <esolangs> [[Kawa/Raw programs]] N https://esolangs.org/w/index.php?oldid=150347 * Aadenboy * (+1417) raw programs
19:18:16 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaJumps.png]]": diacritic indicators
19:18:43 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=150349&oldid=150344 * Aadenboy * (+18) /* Bases */
19:20:10 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaDiacriticFlags.png]]": All the flag diacritics
19:20:18 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=150351&oldid=150349 * Aadenboy * (+54) /* Diacritics */ flags
19:21:24 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaTruthMachine.png]]": add flag
20:23:38 -!- molson has joined.
20:27:49 -!- molson_ has quit (Ping timeout: 260 seconds).
20:35:38 -!- Everything has joined.
20:39:45 -!- Sgeo has joined.
20:58:30 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaBrainfuckImplementation.png]]": [[Brainfuck]] implemented in [[Kawa]]
20:59:55 <esolangs> [[Kawa]] https://esolangs.org/w/index.php?diff=150354&oldid=150351 * Aadenboy * (+165) /* Example Programs */ implemented [[brainfuck]]
21:00:09 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=150355&oldid=150354 * Aadenboy * (+1) /* brainfuck implementation */ damn newline!
21:02:42 <esolangs> [[Special:Log/newusers]] create * Dan422442 * New user account
21:05:16 <esolangs> [[Kawa/Raw programs]] https://esolangs.org/w/index.php?diff=150356&oldid=150347 * Aadenboy * (+2485) add [[File:KawaBrainfuckImplementation.png|brainfuck implementation]]
21:12:31 <esolangs> [[Kawa/Raw programs]] M https://esolangs.org/w/index.php?diff=150357&oldid=150356 * Aadenboy * (+18)
21:27:07 -!- Ae has quit (Killed (NickServ (GHOST command used by ae2!thelounge@user/ae))).
21:27:16 -!- Ae has joined.
21:27:20 -!- Ae has changed nick to Guest6479.
21:29:05 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:44:11 <esolangs> [[Talk:VGFJKDMLFJNDSJHGFYHJDZNYFBICHU,SBYFHDSR,JCBVFBDSJ;]] M https://esolangs.org/w/index.php?diff=150358&oldid=150332 * Aadenboy * (+319)
21:59:40 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=150359&oldid=150248 * Jan jelo * (+101) /* Thue */
22:47:56 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150360&oldid=150343 * Blashyrkh * (+1232) Lazy K example
22:52:46 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150361&oldid=150360 * Blashyrkh * (+60)
23:09:54 -!- Everything has quit (Quit: leaving).
23:23:35 -!- tromp has joined.
23:40:18 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:47:06 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150362&oldid=150361 * Jan jelo * (+97) /* Python 3 */
00:02:50 -!- mtm has quit (Ping timeout: 252 seconds).
00:06:08 -!- mtm has joined.
00:06:22 -!- slavfox has quit (Quit: ZNC 1.8.2 - https://znc.in).
00:06:45 -!- slavfox has joined.
00:17:17 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150363&oldid=150362 * Jan jelo * (+473)
00:22:29 <esolangs> [[Thue]] https://esolangs.org/w/index.php?diff=150364&oldid=150320 * Jan jelo * (+520) /* Sample programs */
00:23:21 <esolangs> [[Thue]] M https://esolangs.org/w/index.php?diff=150365&oldid=150364 * Jan jelo * (+0) /* Sample programs */
00:31:56 <esolangs> [[Thue]] M https://esolangs.org/w/index.php?diff=150366&oldid=150365 * Jan jelo * (-32) /* Sample programs */
00:33:37 -!- __monty__ has quit (Quit: leaving).
00:33:52 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150367&oldid=150363 * Jan jelo * (-31) /* Thue */
01:23:31 -!- impomatic has quit (Quit: Client closed).
02:21:02 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:36:55 -!- ais523 has joined.
02:52:56 <esolangs> [[Translated /PSTF Again4]] https://esolangs.org/w/index.php?diff=150368&oldid=150277 * MihaiEso * (+50)
03:02:30 <esolangs> [[Translated /Mihai Again2]] N https://esolangs.org/w/index.php?oldid=150369 * MihaiEso * (+1102) Created page with "1. Take that [[Translated /PSTF Again4|]]. <pre> </pre> 2. Buy a Windows XP computer and install games on it and game for 24/7 straight. Lastly, destroy the computer, add 100000000000000 kilograms of washing machine and chi..."
03:05:03 -!- op_4 has quit (Remote host closed the connection).
03:05:33 -!- op_4 has joined.
03:10:30 <esolangs> [[Obfunge]] N https://esolangs.org/w/index.php?oldid=150370 * None1 * (+3033) Created page with "'''Obfunge''' is a [[Befunge]]-93 derivative invented by [[User:None1]], it is Befunge-93 but obfuscated. ==Instructions== Befunge-93 has the following commands: {| class="wikitable" !Cmd !Description |- |<code>!</code> |Addition: Pop two values a and b, then push the r
04:32:56 <esolangs> [[Obfunge]] M https://esolangs.org/w/index.php?diff=150371&oldid=150370 * Calculus is fun * (-1) Fixed typo of "Decryption"
04:56:20 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150372&oldid=150367 * Calculus is fun * (+246) Added MoreMathRPN example
04:57:27 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150373&oldid=150273 * Calculus is fun * (+55) /* Examples elsewhere on this site */
05:02:51 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150374&oldid=150372 * Calculus is fun * (+29) /* MoreMathRPN */
05:12:06 <esolangs> [[User:XKCD Random Number]] https://esolangs.org/w/index.php?diff=150375&oldid=150225 * WinslowJosiah * (+302) Correction/addition for Bespoke
05:24:38 <esolangs> [[User:Calculus is fun]] M https://esolangs.org/w/index.php?diff=150376&oldid=150271 * Calculus is fun * (-20) Removed people tag
06:59:16 <esolangs> [[Kawa]] M https://esolangs.org/w/index.php?diff=150377&oldid=150355 * Aadenboy * (+27)
07:03:08 -!- tromp has joined.
07:04:20 -!- tromp has quit (Client Quit).
07:04:50 <esolangs> [[User:UrnEn/Sandbox]] M https://esolangs.org/w/index.php?diff=150378&oldid=150340 * UrnEn * (+0) /* 99 Bottles of Beer in something like Tokipona */
07:10:17 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=150379&oldid=150274 * Aadenboy * (-20) 300!
07:22:08 <esolangs> [[User talk:UrnEn]] M https://esolangs.org/w/index.php?diff=150380&oldid=150341 * UrnEn * (+151)
07:36:10 <esolangs> [[OISC]] M https://esolangs.org/w/index.php?diff=150381&oldid=148981 * Tomhe * (+58) /* External resources */
07:45:59 -!- Noisytoot has quit (Remote host closed the connection).
07:46:57 -!- Noisytoot has joined.
07:59:36 -!- craigo has joined.
08:44:43 -!- tromp has joined.
08:52:11 <esolangs> [[Talk:SendStuff]] M https://esolangs.org/w/index.php?diff=150382&oldid=20017 * Calculus is fun * (+205) Question
09:08:56 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150383&oldid=150374 * PkmnQ * (+900) /* Binary lambda calculus */ Reformat program, add breakdown
09:16:06 -!- craigo has quit (Quit: Leaving).
09:17:01 -!- craigo has joined.
09:42:06 <esolangs> [[Special:Log/newusers]] create * Pantuga * New user account
09:47:50 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150384&oldid=150383 * Jan jelo * (+308) /* Examples */
09:52:33 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150385&oldid=150239 * Pantuga * (+163) /* Introductions */
10:16:30 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150386&oldid=150223 * Jan jelo * (+42) /* Intepreters */
10:19:51 <esolangs> [[Brainfuck/Esointerpreters]] https://esolangs.org/w/index.php?diff=150387&oldid=148766 * Jan jelo * (+4635) /* Standard */
11:17:51 -!- Sgeo has quit (Read error: Connection reset by peer).
11:19:59 -!- ais523 has quit (Quit: quit).
11:28:29 <esolangs> [[Esolang:Categorization]] https://esolangs.org/w/index.php?diff=150388&oldid=150195 * Kevidryon2 * (+27) Added tree-based category
12:02:54 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:36 -!- mtm has joined.
12:07:07 <esolangs> [[Translated /PSTF Again5]] N https://esolangs.org/w/index.php?oldid=150389 * PrySigneToFry * (+5179) Created page with "[[Translated /Mihai Again2|<span style='font-family:Unifont;'>Warning: Your system is corrupted. It can't be trustfEfD?H?H?uHEfD??z ?L? SUVWH?3=??H??Gx4HH$h1 H?uf?^?f?^??Hf??_^][?L? SVWH..."
12:07:43 <esolangs> [[Translated /PSTF Again5]] https://esolangs.org/w/index.php?diff=150390&oldid=150389 * PrySigneToFry * (+58)
12:10:20 <esolangs> [[Translated /Mihai Again2]] https://esolangs.org/w/index.php?diff=150391&oldid=150369 * PrySigneToFry * (+86)
12:30:57 <esolangs> [[User talk:UrnEn]] https://esolangs.org/w/index.php?diff=150392&oldid=150380 * Piet; * (+228) Reply
12:31:29 <esolangs> [[User talk:UrnEn]] M https://esolangs.org/w/index.php?diff=150393&oldid=150392 * Piet; * (+4)
12:31:50 <esolangs> [[User talk:UrnEn]] M https://esolangs.org/w/index.php?diff=150394&oldid=150393 * Piet; * (+0)
12:33:39 <esolangs> [[OISC]] https://esolangs.org/w/index.php?diff=150395&oldid=150381 * Piet; * (+13)
13:06:14 -!- __monty__ has joined.
13:07:35 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:12:09 <esolangs> [[User:ClearLimediWater]] https://esolangs.org/w/index.php?diff=150396&oldid=150018 * ClearLimediWater * (+1393)
14:32:36 -!- tromp has joined.
14:54:42 -!- amby has joined.
15:57:00 <esolangs> [[Joke language list]] M https://esolangs.org/w/index.php?diff=150397&oldid=149951 * TheCanon2 * (+29) /* Example-based languages */
16:02:07 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:24:23 -!- tromp has joined.
16:33:15 <esolangs> [[EsoInterpreters]] M https://esolangs.org/w/index.php?diff=150398&oldid=144784 * TheCanon2 * (+42) Igblan doesn't appear to exist anymore.
16:35:47 <esolangs> [[EsoInterpreters]] M https://esolangs.org/w/index.php?diff=150399&oldid=150398 * TheCanon2 * (+2)
16:39:25 <esolangs> [[EsoInterpreters]] M https://esolangs.org/w/index.php?diff=150400&oldid=150399 * TheCanon2 * (-1) used incorrect link
17:07:41 <esolangs> [[Translated /Mihai Again2]] https://esolangs.org/w/index.php?diff=150401&oldid=150391 * MihaiEso * (+10)
17:09:52 <esolangs> [[Short Minsky Machine Notation]] M https://esolangs.org/w/index.php?diff=150402&oldid=136693 * TheCanon2 * (+110)
17:47:28 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
17:49:53 <esolangs> [[User:TheCanon2]] M https://esolangs.org/w/index.php?diff=150403&oldid=150068 * TheCanon2 * (-4) Or++ Turing completeness disproven
17:51:26 <esolangs> [[MoreMathRPN/brainfuck interpreter]] N https://esolangs.org/w/index.php?oldid=150404 * Calculus is fun * (+2810) Added MoreMathRPN/brainfuck
17:55:48 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150405&oldid=150373 * Calculus is fun * (+153) Brainfuck interpreter
17:56:41 <esolangs> [[MoreMathRPN/brainfuck interpreter]] M https://esolangs.org/w/index.php?diff=150406&oldid=150404 * Calculus is fun * (+12) Changed back location
18:00:10 <esolangs> [[MoreMathRPN/brainfuck interpreter]] M https://esolangs.org/w/index.php?diff=150407&oldid=150406 * Calculus is fun * (+111) Added footnote
18:00:56 <esolangs> [[Special:Log/move]] move * Calculus is fun * moved [[MoreMathRPN/brainfuck interpreter]] to [[MoreMathRPN/Brainfuck interpreter]]: Misspelled title
18:01:30 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150410&oldid=150405 * Calculus is fun * (+0) moved link
18:04:05 <esolangs> [[Brainfuck/Esointerpreters]] M https://esolangs.org/w/index.php?diff=150411&oldid=150387 * Calculus is fun * (+61) Added MoreMathRPN example
18:06:44 -!- tromp has joined.
18:38:33 -!- craigo has quit (Quit: Leaving).
18:41:54 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:46:12 -!- Lord_of_Life has joined.
19:22:25 <esolangs> [[Short Minsky Machine Notation]] https://esolangs.org/w/index.php?diff=150412&oldid=150402 * 47 * (-10) "<pre>" technicaly just shows text unformated
19:23:24 -!- FreeFull has quit.
19:36:51 <esolangs> [[EsoInterpreters]] M https://esolangs.org/w/index.php?diff=150413&oldid=150400 * Aadenboy * (+523) /* Main table */ adding [[kawa]]
19:49:27 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=150414&oldid=149336 * 47 * (+2)
19:49:58 <esolangs> [[Ti!]] https://esolangs.org/w/index.php?diff=150415&oldid=150414 * 47 * (+31)
20:30:31 -!- Sgeo has joined.
20:47:18 -!- FreeFull has joined.
21:35:00 -!- Everything has joined.
22:27:09 -!- Taneb has joined.
22:49:33 <esolangs> [[Brainfuck/Esointerpreters]] M https://esolangs.org/w/index.php?diff=150416&oldid=150411 * Aadenboy * (+125) /* Standard */ add [[Kawa]]
23:13:55 -!- vyv has joined.
23:15:29 -!- Everything has quit (Quit: Lost terminal).
23:30:24 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:37:33 -!- vyv has quit (Quit: Konversation terminated!).
23:43:01 -!- __monty__ has quit (Quit: leaving).
00:03:50 -!- mtm has quit (Ping timeout: 252 seconds).
00:06:24 -!- mtm has joined.
00:42:20 <esolangs> [[MoreMathRPN/Quine]] N https://esolangs.org/w/index.php?oldid=150417 * Calculus is fun * (+2902) Added MoreMathRPN quines
00:47:05 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150418&oldid=150410 * Calculus is fun * (+136) Quines
01:27:47 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150419&oldid=150418 * Aadenboy * (-17)
01:33:37 -!- fowl has quit (Ping timeout: 244 seconds).
01:56:30 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:11:19 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150420&oldid=150419 * Calculus is fun * (+188) added infobox
02:11:42 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150421&oldid=150420 * Calculus is fun * (-4)
02:36:54 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150422&oldid=150384 * Jan jelo * (+537) /* brainfuck */
02:44:57 -!- yewscion has quit (Read error: Connection reset by peer).
02:45:22 -!- yewscion has joined.
02:46:17 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150423&oldid=150422 * Jan jelo * (+4) /* Muriel */
02:47:05 -!- yewscion has quit (Excess Flood).
02:47:23 -!- yewscion has joined.
02:48:39 -!- impomatic has joined.
03:17:26 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150424&oldid=150423 * Jan jelo * (-21) /* brainfuck */
03:28:41 -!- impomatic has quit (Quit: Client closed).
03:29:57 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150425&oldid=150424 * Jan jelo * (+19) /* brainfuck */
03:48:07 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaKolakoskiSequence.png]]": [[Kolakoski sequence]] in [[Kawa]]
03:48:31 <esolangs> [[Kawa]] https://esolangs.org/w/index.php?diff=150427&oldid=150377 * Aadenboy * (+67) /* Example Programs */ add [[Kolakoski sequence]]
03:49:28 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150428&oldid=150425 * Aadenboy * (+114) /* Examples */ add [[Kawa]]
03:49:40 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150429&oldid=150428 * Aadenboy * (+1) /* Kawa */ not again
03:50:15 <esolangs> [[Kawa/Raw programs]] M https://esolangs.org/w/index.php?diff=150430&oldid=150357 * Aadenboy * (+361) add [[Kolakoski sequence]]
04:28:29 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150431&oldid=150429 * Jan jelo * (+17) /* Lazy K */
05:10:06 <esolangs> [[Tiny]] https://esolangs.org/w/index.php?diff=150432&oldid=149685 * Ron.hudson * (-108)
05:12:12 <esolangs> [[Tiny]] https://esolangs.org/w/index.php?diff=150433&oldid=150432 * Ron.hudson * (-73)
05:15:56 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150434&oldid=150431 * Jan jelo * (+67)
05:28:31 -!- Noisytoot has quit (Excess Flood).
05:30:03 -!- Noisytoot has joined.
05:40:37 -!- Noisytoot has quit (Ping timeout: 248 seconds).
05:46:52 -!- Noisytoot has joined.
05:50:54 -!- Noisytoot has quit (Excess Flood).
05:53:50 -!- Noisytoot has joined.
06:06:59 -!- craigo has joined.
07:50:33 -!- tromp has joined.
08:20:14 -!- FreeFull has quit (Ping timeout: 244 seconds).
08:22:00 -!- FreeFull has joined.
08:22:46 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150435&oldid=150434 * Jan jelo * (-8) /* Python 3 */
08:51:18 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
09:05:43 -!- tromp has joined.
10:16:14 -!- __monty__ has joined.
12:03:26 -!- mtm has quit (Ping timeout: 244 seconds).
12:06:59 -!- mtm has joined.
12:27:10 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=150436&oldid=150259 * 47 * (-15) i didn't even notice the double "!"
13:22:41 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150437&oldid=120418 * BrainFuckGirl * (+402) /* Hello World! */ Added another example
13:24:02 <esolangs> [[Mazerunner]] M https://esolangs.org/w/index.php?diff=150438&oldid=150437 * BrainFuckGirl * (+1) /* Hello World! */ spelling mistake
13:27:40 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150439&oldid=150438 * BrainFuckGirl * (+84) /* Cat */ Added example
13:36:42 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:15:42 -!- chomwitt has joined.
14:18:08 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150440&oldid=150439 * BrainFuckGirl * (+73) /* Truth machine */ added example
14:19:53 <esolangs> [[User:BrainFuckGirl]] M https://esolangs.org/w/index.php?diff=150441&oldid=147173 * BrainFuckGirl * (+94) /* Code */
14:23:14 <esolangs> [[User:BrainFuckGirl]] M https://esolangs.org/w/index.php?diff=150442&oldid=150441 * BrainFuckGirl * (+0) /* Brainfuck */ spelling mistakes
14:24:18 <esolangs> [[User:BrainFuckGirl]] M https://esolangs.org/w/index.php?diff=150443&oldid=150442 * BrainFuckGirl * (+0) /* Code */ corrected layout
14:52:18 -!- tromp has joined.
15:48:04 <esolangs> [[Kawa/Raw programs]] M https://esolangs.org/w/index.php?diff=150444&oldid=150430 * Aadenboy * (-177) /* Fibonacci sequence */ make it run forever (it quickly devolves into inf but whatever)
15:48:09 <esolangs> [[Is]] https://esolangs.org/w/index.php?diff=150445&oldid=68171 * Kaveh Yousefi * (+314) Adjusted the i instruction's diction, as the Is language seems to operate on separate bits, rather than bytes, reformatted and reformulated the instruction table, introduced section headers, and supplemented further page category tags.
15:48:33 <esolangs> [[Special:Log/upload]] overwrite * Aadenboy * uploaded a new version of "[[File:KawaFibonacci.png]]": now runs forever
15:49:10 <esolangs> [[Is]] https://esolangs.org/w/index.php?diff=150447&oldid=150445 * Kaveh Yousefi * (+4459) Added an interpreter implementation in Common Lisp.
15:57:42 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:13:39 -!- tromp has joined.
16:22:14 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=150448&oldid=149958 * TheCanon2 * (+17) Added full cat
16:26:49 <esolangs> [[Hito]] M https://esolangs.org/w/index.php?diff=150449&oldid=150448 * TheCanon2 * (+43) added EOF=-1 variant
16:45:09 -!- tromp has quit (Read error: Connection reset by peer).
17:13:05 -!- Sgeo_ has joined.
17:13:34 -!- Sgeo has quit (Read error: Connection reset by peer).
17:33:07 <esolangs> [[Bake]] https://esolangs.org/w/index.php?diff=150450&oldid=144909 * 47 * (+4) /* Syntax */
17:33:24 <esolangs> [[Bake]] https://esolangs.org/w/index.php?diff=150451&oldid=150450 * 47 * (+0) /* Examples */
18:06:16 -!- craigo has quit (Quit: Leaving).
18:11:56 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150452&oldid=150435 * Calculus is fun * (+333) /* FALSE */
18:42:47 -!- Lord_of_Life_ has joined.
18:43:07 -!- Lord_of_Life has quit (Ping timeout: 265 seconds).
18:45:43 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
20:15:29 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150453&oldid=149594 * Dmiz * (+167)
20:18:57 -!- amby has joined.
20:30:19 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150454&oldid=150106 * Jan jelo * (+829)
20:38:27 <esolangs> [[Snakel/Compatibility methods]] https://esolangs.org/w/index.php?diff=150455&oldid=150032 * Ractangle * (-1) /* Ultium */
20:42:06 <esolangs> [[Dir]] https://esolangs.org/w/index.php?diff=150456&oldid=149113 * CCeriseGD * (+2956) documentation
21:25:51 -!- chomwitt has quit (Ping timeout: 246 seconds).
22:18:39 -!- Everything has joined.
22:47:37 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150457&oldid=150454 * Jan jelo * (+715) /* Thue */
22:48:49 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150458&oldid=150457 * Jan jelo * (-715) /* Thue */
22:52:45 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150459&oldid=150458 * Jan jelo * (+101) /* Thue */
23:06:42 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=150460&oldid=149917 * AdjectiveNounNumber * (-183)
23:14:27 -!- __monty__ has quit (Quit: leaving).
23:17:17 <esolangs> [[Kiwiscript]] https://esolangs.org/w/index.php?diff=150461&oldid=149283 * AdjectiveNounNumber * (+75) /* Examples */
23:18:13 -!- Everything has quit (Quit: leaving).
23:32:46 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150462&oldid=150459 * Jan jelo * (+66) /* Thue */
23:33:01 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150463&oldid=150462 * Jan jelo * (+1) /* Thue */
00:02:36 -!- mtm has quit (Ping timeout: 265 seconds).
00:06:38 -!- mtm has joined.
00:59:56 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
01:26:19 -!- ais523 has joined.
01:27:47 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150464&oldid=150463 * Jan jelo * (+245) /* JavaScript */
03:13:52 -!- yewscion_ has joined.
03:15:38 -!- yewscion has quit (Ping timeout: 272 seconds).
03:24:15 -!- ais523 has quit (Ping timeout: 246 seconds).
04:25:21 -!- ais523 has joined.
04:26:38 -!- yewscion_ has quit (Read error: Connection reset by peer).
04:26:55 -!- yewscion_ has joined.
04:27:43 <esolangs> [[MoreMathRPN/Quine]] https://esolangs.org/w/index.php?diff=150465&oldid=150417 * Calculus is fun * (+244) Better explanation of quine
04:38:25 -!- yewscion_ has quit (Remote host closed the connection).
04:39:48 <zzo38> I had read today in library about someone invented "floating floating point" that the number of bits of exponent and fraction part can be varied.
04:57:23 -!- pococuranteconfi has joined.
05:22:38 -!- pococuranteconfi has quit (Read error: Connection reset by peer).
05:53:39 <ais523> hmm, you could also have a floating-point variant where the exponent was itself a floating-point number (but the range of exponents for the exponent would not include negative numbers, as those wouldn't be useful)
05:58:28 <zzo38> It is what I thought before I had finished reading the article.
06:06:04 <ais523> this reminds me of a number format I was thinking about, which consists of a length followed by digits, and the length is recursively written in the same format (with a special case for 1 so that the recursion has a base case)
07:18:18 -!- Sgeo_ has quit (Read error: Connection reset by peer).
07:33:49 <b_jonas> ais523, zzo38: https://logs.esolangs.org/libera-esolangs/2025-01.html#lEc
07:34:11 <b_jonas> which links to https://adamscherlis.github.io/blog/iterlog-coding/
07:36:27 <ais523> hmm, it doesn't seem very good at encoding integers
07:49:02 <b_jonas> ais523: for natural numbers, Amicus encodes them as the list of the lengths of runs of zeros in the binary digits of the number, where each length is represented the same way. this is nice because it's a bijection between natural numbers and lists.
07:49:08 <b_jonas> https://esolangs.org/wiki/Amicus
07:49:48 <ais523> what number does an empty list represent? 0 or 1?
07:50:40 <ais523> oh, presumably 0 is [] and 1 is [0]
07:50:46 <b_jonas> an empty list represents 0; 1 is represented by a list containing an empty list because there's an empty run of zeros to the right of the one digit
07:51:05 <ais523> right, and you have one element for each 1 bit in the number
07:52:04 <esolangs> [[Text]] https://esolangs.org/w/index.php?diff=150466&oldid=144969 * BrainFuckGirl * (+31) /* Development of a compiler */ added compiler in ><>
07:53:25 <ais523> this is also interesting because it gives a bijection between balanced strings (which only contain the bracketing symbols and nothing else) and natural numbers (due to the obvious bijection between balanced strings and lists)
07:56:13 <b_jonas> as for the length followed by digits with the length encoded the same way, I thought I've seen that somewhere. but I just checked the ICFP 2007 task spec, and no, FUUN DNA does not use that representation. it uses a simple binary with a terminator symbol.
07:58:23 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150467&oldid=150421 * Calculus is fun * (+109) Added new commands
08:03:27 <ais523> I wrote a program that outputs Amicus encodings: https://tio.run/##AT0Awv9qZWxsef//QuG5ozHhuojhuIrDn@KCrArhuLbDh@KCrMWS4bmY4oCdwrbIrsKkJOKCrOG5m@KAnP///zY0
08:05:22 <b_jonas> ais523: https://esolangs.org/wiki/Amycus#Implementing tells how to increment a number in the Amicus representation, zzo38 helped me figure this out long ago
08:05:50 <b_jonas> so in theory you could iterate that rule to get the encodings
08:07:46 <ais523> (the first line is the encoder, the second line iterates over numbers from 0 to input-1 and prints the list readably)
08:12:27 <b_jonas> the power of two thing kind of bothers me, and I wonder if you could get a better encoding by recursively applying a more tame bijection between numbers and pairs of numbers. (0) ships with such a correspondence built in, but it's not quite right, because it maps 0 itself to the pair (0, 0), and you want a mapping that excludes 0.\
08:14:05 <esolangs> [[Meowlang]] https://esolangs.org/w/index.php?diff=150468&oldid=119743 * BrainFuckGirl * (+53) /* Interpreters */ added categories
08:16:39 <b_jonas> though the Amicus representation lets you go further, trying to apply the (0) representation recursively will end up in an infinite loop pretty early
08:37:29 <b_jonas> my previous statemetn is wrong, both get stuck at omega first
08:54:45 -!- ais523 has quit (Quit: quit).
09:37:04 -!- amby has joined.
09:40:15 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150469&oldid=150318 * PrySigneToFry * (+282)
09:48:24 -!- tromp has joined.
10:11:25 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:13:08 -!- citrons has quit (Ping timeout: 252 seconds).
10:14:47 -!- citrons has joined.
10:51:36 -!- tromp has joined.
11:25:42 -!- craigo has joined.
12:03:12 -!- mtm has quit (Ping timeout: 272 seconds).
12:06:33 -!- mtm has joined.
12:07:36 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150470&oldid=150440 * BrainFuckGirl * (+466) /* Code examples */ added Example
12:21:57 -!- craigo has quit (Quit: Leaving).
12:40:45 -!- chomwitt has joined.
12:44:32 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:09:27 -!- chomwitt has quit (Ping timeout: 246 seconds).
13:13:29 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150471&oldid=150469 * PrySigneToFry * (+996)
13:57:43 -!- tromp has joined.
14:00:46 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150472&oldid=150467 * Calculus is fun * (+443) Added new function commands!
14:04:05 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150473&oldid=150472 * Calculus is fun * (+4) Fixed header hierarchy
14:33:06 <esolangs> [[MoreMathRPN/Quine]] M https://esolangs.org/w/index.php?diff=150474&oldid=150465 * Calculus is fun * (+67) MInor remark
14:34:19 <esolangs> [[MoreMathRPN/Quine]] M https://esolangs.org/w/index.php?diff=150475&oldid=150474 * Calculus is fun * (+2)
14:36:59 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=150476&oldid=149566 * I am islptng * (-88)
14:54:32 <esolangs> [[UpDown]] https://esolangs.org/w/index.php?diff=150477&oldid=124084 * IdfbAn * (+10) Distinguish variables that underflow and overflow error messages refer to
14:56:49 <esolangs> [[UpDown]] https://esolangs.org/w/index.php?diff=150478&oldid=150477 * IdfbAn * (+5) Make UpDown and UD++ command descriptions consistent
15:32:23 -!- chomwitt has joined.
15:36:40 -!- wib_jonas has joined.
15:38:37 <wib_jonas> ais523: I think the Jelly snippet that you gave is outputting all the lists reversed
16:04:25 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:16:41 -!- tromp has joined.
16:17:52 <esolangs> [[Amycus]] https://esolangs.org/w/index.php?diff=150479&oldid=75726 * B jonas * (+0) /* Implementing */ there was one more typo in the formula
16:35:06 -!- tromp has quit (Read error: Connection reset by peer).
16:38:41 <wib_jonas> I mean all the recursive sublists reversed to be clear
16:48:48 -!- wib_jonas has quit (Quit: Client closed).
17:35:47 <esolangs> [[Special:Log/newusers]] create * Gotz * New user account
17:40:20 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150480&oldid=150473 * Calculus is fun * (+14) minor format
17:49:53 -!- m5zs7k_ has joined.
17:50:43 -!- Melvar has quit (Ping timeout: 252 seconds).
17:50:45 -!- jix has quit (Ping timeout: 248 seconds).
17:51:08 -!- Melvar has joined.
17:51:24 -!- m5zs7k has quit (Read error: Connection reset by peer).
17:52:43 -!- jix has joined.
17:59:51 -!- m5zs7k_ has changed nick to m5zs7k.
18:09:08 -!- lynndotpy6 has quit (Quit: bye bye).
18:10:02 -!- lynndotpy6 has joined.
18:42:21 -!- Lord_of_Life_ has joined.
18:43:33 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:43:42 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
19:38:36 <esolangs> [[true]] https://esolangs.org/w/index.php?diff=150481&oldid=148975 * 47 * (+39) /* Commands */
20:01:03 <esolangs> [[Vfl]] https://esolangs.org/w/index.php?diff=150482&oldid=130893 * 47 * (+69) /* External links */
20:01:19 <esolangs> [[Vfl]] https://esolangs.org/w/index.php?diff=150483&oldid=150482 * 47 * (+0) /* External links */
20:20:34 -!- chomwitt has quit (Ping timeout: 248 seconds).
20:31:51 <esolangs> [[Nopstacle]] https://esolangs.org/w/index.php?diff=150484&oldid=148737 * Ais523 * (-5) Undo revision [[Special:Diff/148737|148737]] by [[Special:Contributions/Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff|Fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff]] ([[User talk:Fffffffffffffffffffffffffffffffffffffffffffffffffffffffff
20:41:56 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150485&oldid=150480 * Calculus is fun * (+365) Added inputSE
21:03:43 -!- ais523 has joined.
21:28:29 -!- Everything has joined.
21:29:39 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150486&oldid=150464 * Jan jelo * (+119)
21:30:53 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150487&oldid=150486 * Jan jelo * (+0) /* Smalltalk */
21:34:19 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150488&oldid=150487 * Jan jelo * (+29) /* Uiua */
21:41:08 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150489&oldid=150485 * Calculus is fun * (+228) Added function example
21:50:28 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150490&oldid=150488 * Jan jelo * (+33) /* Uiua */
22:14:24 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150491&oldid=150489 * Calculus is fun * (+118) /* Using run */
23:20:31 -!- Sgeo has joined.
23:25:17 -!- Everything has quit (Quit: leaving).
23:40:57 <esolangs> [[Special:Log/newusers]] create * Somefan * New user account
23:55:20 -!- somefan has joined.
00:00:00 -!- somefan has quit (Client Quit).
00:03:49 -!- mtm has quit (Ping timeout: 260 seconds).
00:06:52 -!- mtm has joined.
00:09:08 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150492&oldid=150385 * Somefan * (+162)
00:09:22 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150493&oldid=150492 * Somefan * (+83)
00:11:32 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150494&oldid=150493 * Somefan * (+1)
00:18:16 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150495&oldid=150490 * Jan jelo * (+83) /* Deadfish++ */
00:23:42 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150496&oldid=150495 * Jan jelo * (-1) /* Desmos */
00:33:41 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150497&oldid=150496 * Jan jelo * (-25) /* Smalltalk */
00:48:34 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150498&oldid=150497 * Jan jelo * (+50) /* Bash */
01:57:45 <esolangs> [[true]] https://esolangs.org/w/index.php?diff=150499&oldid=150481 * Somefan * (+25)
01:59:25 <esolangs> [[true]] https://esolangs.org/w/index.php?diff=150500&oldid=150499 * Somefan * (+48)
02:05:23 <esolangs> [[User:Somefan]] N https://esolangs.org/w/index.php?oldid=150501 * Somefan * (+242) Created page with "{{lowercase}} <div style="text-transform: lowercase; font-size: 1.5em;"> Hi, my name is '''Fan0102''', '''Fan''', and '''SomeFan''' simultaneously, although I prefer the last two. [https://somefan0102.neocities.org here is my website] </div>"
02:21:34 <esolangs> [[Iterate]] N https://esolangs.org/w/index.php?oldid=150502 * Aadenboy * (+2418) Created page with "{{Distinguish/Confusion|Iterate}} Iterate is a program by [[User:Aadenboy]] which only uses iterative loops. == Syntax == === Loops === Loops are initialized with an asterisk (optionally with a number preceding it surrounded by parentheses), followed by the amount of
02:22:03 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=150503&oldid=150379 * Aadenboy * (+54) /* who. who are you */ add [[Iterate]]
02:22:38 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=150504&oldid=150313 * Aadenboy * (+14) /* I */ add [[Iterate]]
02:25:05 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150505&oldid=150502 * Aadenboy * (+123) /* Examples */ [[Truth-machine]]
02:26:04 <esolangs> [[User talk:Somefan]] N https://esolangs.org/w/index.php?oldid=150506 * Aadenboy * (+324) Created page with "well I didn't expect to see you here! ~~~~"
02:33:00 <esolangs> [[User talk:Somefan]] https://esolangs.org/w/index.php?diff=150507&oldid=150506 * Somefan * (+232)
02:35:56 <esolangs> [[User talk:Somefan]] https://esolangs.org/w/index.php?diff=150508&oldid=150507 * Aadenboy * (+298)
02:50:48 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:16:01 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150509&oldid=143784 * WoodyFan3412 * (+204) Added JavaScript Implementation
03:26:21 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150510&oldid=150498 * Jan jelo * (+0) /* Desmos */
03:56:22 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150511&oldid=150510 * Aadenboy * (+422) add [[Iterate]], [[Kawa]], [[MEMORYLEEK]] and [[Trampolines]]
04:05:37 -!- Sgeo has quit (Read error: Connection reset by peer).
04:24:28 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150512&oldid=150491 * Calculus is fun * (+423) /* Ackermann function */
05:18:53 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150513&oldid=150242 * Jan jelo * (+85) /* Uiua */
05:35:04 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150514&oldid=150505 * Aadenboy * (+92) /* Completeness */ Iterate might not be Turing complete
05:35:46 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150515&oldid=150514 * Aadenboy * (+0) fix distinguish link
05:36:15 <esolangs> [[ITERATE]] M https://esolangs.org/w/index.php?diff=150516&oldid=118406 * Aadenboy * (+34) distinguish
06:04:35 -!- Sgeo has joined.
06:13:57 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150517&oldid=149671 * DGCK81LNN * (+268)
06:19:09 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150518&oldid=150517 * DGCK81LNN * (+7) /* Koishi runtime specific */
06:20:04 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150519&oldid=150518 * DGCK81LNN * (-2) /* Example programs */
06:22:25 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150520&oldid=150513 * Jan jelo * (+98) /* WhatLang */
06:29:49 <esolangs> [[FizzBuzz]] https://esolangs.org/w/index.php?diff=150521&oldid=150520 * Jan jelo * (+86) /* WhatLang */
06:55:03 <esolangs> [[FizzBuzz]] M https://esolangs.org/w/index.php?diff=150522&oldid=150521 * Jan jelo * (+83) /* Uiua */
07:50:27 -!- Sgeo has quit (Read error: Connection reset by peer).
07:52:13 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150523&oldid=150470 * BrainFuckGirl * (+349) /* Code examples */ added Disan Count example
08:07:23 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150524&oldid=150509 * 47 * (+95) /* Python 3 */
08:08:29 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150525&oldid=150524 * 47 * (+1) /* Python 3 */
08:11:14 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150526&oldid=150525 * 47 * (-1) /* Python 3 */
08:11:58 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150527&oldid=150526 * 47 * (-2) /* Python 3 */
08:12:36 -!- mtm has quit (Ping timeout: 244 seconds).
08:14:31 -!- mtm has joined.
08:27:04 -!- craigo has joined.
10:15:28 -!- tromp has joined.
10:52:43 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150528&oldid=150471 * PrySigneToFry * (+15)
11:04:10 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150529&oldid=150528 * PrySigneToFry * (+758)
11:14:02 -!- ais523 has quit (Quit: quit).
11:47:50 -!- m5zs7k has quit (Ping timeout: 244 seconds).
11:52:47 -!- m5zs7k has joined.
12:03:39 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:52 -!- mtm has joined.
12:26:50 -!- m5zs7k has quit (Ping timeout: 272 seconds).
12:31:42 -!- chomwitt has joined.
12:32:24 -!- m5zs7k has joined.
12:32:41 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:40:54 <esolangs> [[Special:Log/newusers]] create * (()()) * New user account
12:43:33 <esolangs> [[Esolang:Introduce yourself]] M https://esolangs.org/w/index.php?diff=150530&oldid=150494 * (()()) * (+109) added myself
12:56:43 -!- tromp has joined.
13:01:06 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150531&oldid=150529 * PrySigneToFry * (+1482)
13:09:32 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150532&oldid=150531 * PrySigneToFry * (+412)
13:11:24 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150533&oldid=150530 * (()()) * (+0)
13:20:27 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150534&oldid=150323 * PrySigneToFry * (+990)
13:21:31 -!- Everything has joined.
13:22:24 <esolangs> [[X-Script]] N https://esolangs.org/w/index.php?oldid=150535 * PrySigneToFry * (+175) Created page with "This is a redirect page. If you want to learn about X-script, but you make a case mistake, you will be redirected to the correct page through this page. #REDIRECT [[X-script]]"
13:22:42 <esolangs> [[X-Script]] https://esolangs.org/w/index.php?diff=150536&oldid=150535 * PrySigneToFry * (+1) Redirected page to [[X-script]]
13:23:38 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150537&oldid=150532 * PrySigneToFry * (+43)
13:29:36 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150538&oldid=150339 * PrySigneToFry * (+176)
13:44:30 <esolangs> [[User talk:Aadenboy]] https://esolangs.org/w/index.php?diff=150539&oldid=148882 * PrySigneToFry * (+217) /* Some excellent sans-serif fonts for you, by PSTF */ new section
13:44:31 <esolangs> [[Talk:A+B Problem]] N https://esolangs.org/w/index.php?oldid=150540 * Blashyrkh * (+234) Created page with "[[A+B Problem#Subleq]] should be considered a cheating. The language supports IO, so why don't give an example that uses all language features? --~~~~"
14:18:50 <esolangs> [[0134]] https://esolangs.org/w/index.php?diff=150541&oldid=136403 * PrySigneToFry * (-1) Fixed command for unconfusing
14:35:29 -!- Sgeo has joined.
14:37:06 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:41:35 -!- tromp has joined.
14:49:45 -!- amby has joined.
15:14:26 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150542&oldid=150519 * DGCK81LNN * (+4542) /* Koishi runtime specific */
15:40:33 -!- chomwitt has quit (Ping timeout: 244 seconds).
15:55:01 <esolangs> [[0134]] https://esolangs.org/w/index.php?diff=150543&oldid=150541 * Ractangle * (+1) oh no you don't
16:11:09 <esolangs> [[User talk:Aadenboy]] https://esolangs.org/w/index.php?diff=150544&oldid=150539 * Aadenboy * (+405)
16:13:30 <esolangs> [[Special:Log/upload]] upload * Aadenboy * uploaded "[[File:KawaA+BProblem.png]]": lmao I forgot to upload it
16:39:58 -!- chomwitt has joined.
16:42:50 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150546&oldid=150542 * DGCK81LNN * (-61) rephrase everything about the Frame Stack
16:46:50 -!- Everything has quit (Ping timeout: 252 seconds).
17:11:09 <korvo> Ugh. I have a cool idea for graphical syntax for sheaves over (psuedometric) (vector) spaces, but I don't know how to parse it.
17:11:36 <korvo> I *do* know a language that would require similar parsing, and that is implemented, and that doesn't really do much besides parsing...
17:35:05 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150547&oldid=150515 * Aadenboy * (+27) category
17:39:36 <esolangs> [[Talk:Iterate]] N https://esolangs.org/w/index.php?oldid=150548 * Aadenboy * (+735) Created page with "would there be a way to prove what computational class Iterate is? not really sure how to go about this I know it isn't a [[Finite-state automaton]] simply from this code: <pre> (*)< *=1< @ > // loops once on the second pass, then twice on the third, three times
17:54:11 <esolangs> [[User talk:Aadenboy]] M https://esolangs.org/w/index.php?diff=150549&oldid=150544 * Aadenboy * (+55)
17:55:35 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150550&oldid=150512 * Calculus is fun * (-4) /* 99 bottles of beer */
18:03:58 <esolangs> [[Talk:Iterate]] https://esolangs.org/w/index.php?diff=150551&oldid=150548 * Corbin * (+198) It's very funny that I keep citing this theorem; I happen to hate it.
18:14:48 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150552&oldid=150527 * Ractangle * (-15) /* Python 3 */
18:16:10 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150553&oldid=150547 * Aadenboy * (+434) /* Examples */ comments
18:20:02 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150554&oldid=150552 * Aadenboy * (+240) add Lua
18:20:46 <esolangs> [[InterpretMe]] M https://esolangs.org/w/index.php?diff=150555&oldid=150554 * Aadenboy * (+1) /* Lua */
18:32:11 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150556&oldid=150546 * DGCK81LNN * (+3954)
18:33:01 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150557&oldid=150556 * DGCK81LNN * (+0) /* WhatNoter */
18:43:53 -!- Lord_of_Life_ has joined.
18:44:18 -!- Lord_of_Life has quit (Ping timeout: 246 seconds).
18:46:49 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:59:55 -!- Everything has joined.
19:21:23 <esolangs> [[Funciton]] M https://esolangs.org/w/index.php?diff=150558&oldid=150330 * Timwi * (+15) /* Features */
19:26:33 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150559&oldid=150557 * Jan jelo * (-20) /* Example programs */ wait,I can use the repr@
19:30:36 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150560&oldid=150555 * 47 * (+14) /* Python 3 */
19:34:48 <esolangs> [[Funciton]] M https://esolangs.org/w/index.php?diff=150561&oldid=150558 * Timwi * (+35) /* Problem #3: it doesnt work with negative numbers */
19:36:43 <esolangs> [[Looping counter]] https://esolangs.org/w/index.php?diff=150562&oldid=150359 * Jan jelo * (+39) /* WhatLang */
19:38:33 <esolangs> [[Funciton]] M https://esolangs.org/w/index.php?diff=150563&oldid=150561 * Timwi * (+11) /* Strings */
19:56:53 -!- somefan has joined.
19:57:21 -!- somefan has quit (Client Quit).
19:57:41 <esolangs> [[Funciton]] M https://esolangs.org/w/index.php?diff=150564&oldid=150563 * Timwi * (+0) /* Lazy sequences */
19:59:33 -!- visilii_ has joined.
20:02:58 -!- visilii has quit (Ping timeout: 248 seconds).
20:12:57 <esolangs> [[Stub]] M https://esolangs.org/w/index.php?diff=150565&oldid=142430 * Aadenboy * (-35) what am I talking about? this isn't a brainfuck deriv!
20:13:25 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=150566&oldid=150503 * Aadenboy * (-5)
20:36:03 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150567&oldid=150559 * Jan jelo * (+170) /* Practices and idioms */
21:06:11 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=150568&oldid=149667 * Jan jelo * (+219) /* Upsilon */
21:18:13 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=150569&oldid=150568 * Jan jelo * (+91) /* WhatLang */
21:18:43 <esolangs> [[Factorial]] M https://esolangs.org/w/index.php?diff=150570&oldid=150569 * Jan jelo * (+0) /* WhatLang */
21:42:09 -!- chomwitt has quit (Ping timeout: 248 seconds).
21:48:13 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=150571&oldid=150570 * Jan jelo * (+111) /* Recs */
21:50:17 -!- craigo has quit (Quit: Leaving).
21:52:50 <esolangs> [[Counterlang]] https://esolangs.org/w/index.php?diff=150572&oldid=123936 * Kaveh Yousefi * (+1636) Supplemented an Extended Backus-Naur Form (EBNF) description of the syntax, introduced an examples section comprehending an incipial member, added a hyperlink to my implementation on GitHub, and supplied several page category tags.
22:10:41 <esolangs> [[Recs]] M https://esolangs.org/w/index.php?diff=150573&oldid=149668 * Jan jelo * (+15) /* Reduce */
22:13:07 <esolangs> [[Recs]] M https://esolangs.org/w/index.php?diff=150574&oldid=150573 * Jan jelo * (-2) /* fn */
22:20:59 -!- visilii has joined.
22:23:03 -!- visilii_ has quit (Ping timeout: 246 seconds).
22:25:06 <zzo38> Is there any name for a monad that uses a identity functor, and/or if the Kleisli category is as good as the original category? (A identity monad has both of these properties, but I mean in general, if there are any.)
22:25:42 <korvo> "codensity monad" might be the phrase to look up.
22:26:29 <korvo> In general, the identity functor only carries the identity monad, but sometimes there are cases where identity can be naturally transformed to/from something more interesting. Continuation monads are a fun motivating example.
22:33:22 <zzo38> Can nonzero scalar multiples make monads of category of matrices? To me it seemed to do, and is with identity functor?
22:35:10 <korvo> Yes, I think so. Let K be our set of scalars and Mat(K) be the category with natural numbers for objects and matrices/linear transformations for arrows. Composition is matrix multiplication.
22:36:17 <korvo> Oh, hm. I was going to build endofunctors, but I'm having trouble finding them. For 1 in K, there's an identity functor which scales everything by 1; but no other scalar is compatible with the functor laws.
22:40:51 <zzo38> Of course the identity functor scales everything by 1, but I mean the natural transformations (eta and mu) of the monad, not the functor itself.
22:43:46 <korvo> I suppose it depends on K. Any idea where the monad's underlying adjunction might go?
22:46:20 -!- Everything has quit (Quit: leaving).
22:49:05 <esolangs> [[Factorial]] https://esolangs.org/w/index.php?diff=150575&oldid=150571 * Jan jelo * (+3) /* WhatLang */
22:54:05 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
22:54:32 <zzo38> As far as I can tell, in this case, the Kleisli category is as good as the original category, but all of the numbers are scaled, and the components are the identity matrix multiplied or divided by a scalar, and since they are scalar that also means that they are commutative. This means that the Kleisli composition will divide by the scalar that you had originally multiplied by, in order to restore the original value.
22:56:44 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150576&oldid=150567 * Jan jelo * (+155) /* Practices and idioms */
23:15:20 <zzo38> (Hopefully, I am not being unclear or wrong, so far)
23:23:53 <korvo> It's clear, but I'm stumped and don't know how to proceed. I feel like a linear-algebra expert would have more insight.
23:24:58 <korvo> If the chosen scalar is invertible, then the Kleisli category would be equivalent to the original category and the functors would be "identity-on-objects", which is a concept that can't be made isomorphism-invariant.
23:25:29 <korvo> This isn't wrong, but it is what folks call "evil", and suggests that there's some unaccounted structure in the setup.
23:25:42 <korvo> ...Which suggests that my setup is fairly wrong.
23:53:58 <esolangs> [[Is it]] https://esolangs.org/w/index.php?diff=150577&oldid=128199 * Somefan * (-4485) I think this would be best suited as a redirect rather then a duplicate. Do correct me if i'm wrong
00:04:05 -!- mtm has quit (Ping timeout: 248 seconds).
00:06:13 -!- mtm has joined.
00:38:01 <esolangs> [[Looping counter]] M https://esolangs.org/w/index.php?diff=150578&oldid=150562 * Aadenboy * (+158) add [[Iterate]]
00:39:08 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150579&oldid=150553 * Aadenboy * (+140) /* Examples */ add [[Looping counter]]
00:53:06 <esolangs> [[Deadfish~]] M https://esolangs.org/w/index.php?diff=150580&oldid=139804 * TheCanon2 * (+58)
01:27:06 <esolangs> [[Numeric]] https://esolangs.org/w/index.php?diff=150581&oldid=149273 * Dmiz * (+9)
01:31:25 <esolangs> [[User:Somefan]] https://esolangs.org/w/index.php?diff=150582&oldid=150501 * Somefan * (-18)
01:51:18 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:27:07 <esolangs> [[BitTurn]] https://esolangs.org/w/index.php?diff=150583&oldid=150194 * I am islptng * (+21)
03:14:21 <esolangs> [[User talk:Aadenboy]] https://esolangs.org/w/index.php?diff=150584&oldid=150549 * PrySigneToFry * (+519)
03:15:12 <esolangs> [[User talk:Aadenboy]] https://esolangs.org/w/index.php?diff=150585&oldid=150584 * PrySigneToFry * (+836) Added a signature
03:53:50 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150586&oldid=150511 * Jan jelo * (-10) /* JavaScript */
04:02:29 <esolangs> [[X-script/Examples]] N https://esolangs.org/w/index.php?oldid=150587 * PrySigneToFry * (+482) Created page with "{{Back|X-script}} Here is some X-script example. = Hello, world! = print("Hello, world!") == By output file == print("Hello, world!", file = "test.out") # If the file doesn't exist, X-script will automatically create it. print("", end = "", file = "C
04:38:00 <esolangs> [[99 bottles of beer]] https://esolangs.org/w/index.php?diff=150588&oldid=149079 * Jan jelo * (+258) /* Wenyan */
04:39:18 <esolangs> [[99 bottles of beer]] M https://esolangs.org/w/index.php?diff=150589&oldid=150588 * Jan jelo * (+1) /* WhatLang */
04:59:10 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150590&oldid=150537 * PrySigneToFry * (+12) Fixed
05:06:23 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150591&oldid=150590 * PrySigneToFry * (+366)
05:08:41 <esolangs> [[X-script/Examples]] https://esolangs.org/w/index.php?diff=150592&oldid=150587 * PrySigneToFry * (+368)
05:12:29 <esolangs> [[Basilisk]] https://esolangs.org/w/index.php?diff=150593&oldid=144822 * PrySigneToFry * (+284)
05:13:23 <esolangs> [[Talk:Basilisk]] https://esolangs.org/w/index.php?diff=150594&oldid=143818 * PrySigneToFry * (+885) /* I think Basilisk will do nothing on APLWSI. */ new section
05:14:13 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150595&oldid=150591 * PrySigneToFry * (+58)
05:16:34 <esolangs> [[0134]] https://esolangs.org/w/index.php?diff=150596&oldid=150543 * PrySigneToFry * (+102)
05:21:54 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=150597&oldid=149922 * PrySigneToFry * (+1097) /* Soft redirect */ new section
05:26:52 <esolangs> [[Talk:SLet]] https://esolangs.org/w/index.php?diff=150598&oldid=146835 * PrySigneToFry * (+1017)
06:16:36 <esolangs> [[99 bottles of beer]] https://esolangs.org/w/index.php?diff=150599&oldid=150589 * Jan jelo * (+266) /* List of implementations (non-esolangs) */
06:22:55 <korvo> Parsing But Is It Art? is not fun. It's like the worst parts of sprite-handling routines. I seem to have more fenceposts than successfully-parsed tiles.
06:25:38 <korvo> One interesting thing I found: I'm not sure BIIA? admits a single-pass parser. I found that I had to first lay out the program in memory as a graph-theoretic object and then run two graph traversals, first to find the bounding box of the tile and second to cut/copy the tile to its own little sprite.
06:27:30 <korvo> Doing a single unified traversal would be tricky. The bounding box isn't just for memory, but for making progress in the parse. That said, perhaps it's merely too late at night for me to see a simpler solution.
06:45:24 -!- m5zs7k has quit (Ping timeout: 260 seconds).
06:47:24 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150600&oldid=150017 * PrySigneToFry * (+509)
06:48:48 -!- m5zs7k has joined.
06:51:14 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150601&oldid=150576 * DGCK81LNN * (+0) /* Instructions */
06:57:52 <esolangs> [[Deadfish~]] https://esolangs.org/w/index.php?diff=150602&oldid=150580 * Ractangle * (+17) Fixed a tiny thing
07:01:06 <esolangs> [[Talk:Basilisk]] https://esolangs.org/w/index.php?diff=150603&oldid=150594 * Ractangle * (+180) /* I think Basilisk will do nothing on APLWSI. */
07:36:25 -!- tromp has joined.
08:42:36 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150604&oldid=149831 * Jan jelo * (+123) /* Haskell */
08:49:58 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=150605&oldid=150604 * Jan jelo * (+38) /* Uiua */
09:01:50 <esolangs> [[InterpretMe]] https://esolangs.org/w/index.php?diff=150606&oldid=150560 * WoodyFan3412 * (+111) golfed version
09:07:02 -!- Sgeo has quit (Read error: Connection reset by peer).
09:12:10 <esolangs> [[Talk:Basilisk]] https://esolangs.org/w/index.php?diff=150607&oldid=150603 * PrySigneToFry * (+886)
09:19:10 <esolangs> [[User:Tommyaweosme]] https://esolangs.org/w/index.php?diff=150608&oldid=148897 * PrySigneToFry * (+16) Fixed case-error and missing punctuations
09:23:42 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:31:12 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150609&oldid=150586 * Jan jelo * (+291) /* JavaScript */
10:31:49 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150610&oldid=150609 * Jan jelo * (+0) /* JavaScript */
10:36:46 -!- tromp has joined.
12:03:19 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:49 -!- mtm has joined.
12:16:14 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150611&oldid=150601 * DGCK81LNN * (+311)
12:28:26 -!- chomwitt has joined.
12:41:02 <esolangs> [[User:Jan jelo/My first BF quine]] N https://esolangs.org/w/index.php?oldid=150612 * Jan jelo * (+7694) Created page with "This is a [[Quine]] in [[Brainfuck]] by [[User: Jan jelo]]. It contains 7575 characters. <pre class="rectwrap"> ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++>>>++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++>>>+++++++
12:43:08 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150613&oldid=150605 * Jan jelo * (+7647) /* Blood32 */
12:45:46 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150614&oldid=150386 * Jan jelo * (+37) /* Other */
12:52:03 -!- chomwitt has quit (Ping timeout: 252 seconds).
13:04:15 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150615&oldid=150233 * I am islptng * (+562) /* */
13:12:53 <esolangs> [[Talk:SLet]] https://esolangs.org/w/index.php?diff=150616&oldid=150598 * I am islptng * (+820) /* Suggested commands */
13:54:02 -!- amby has joined.
14:03:46 -!- craigo has joined.
14:07:33 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
14:36:16 <esolangs> [[NOR Machine]] N https://esolangs.org/w/index.php?oldid=150617 * Unname4798 * (+428) Created page with "NOR Machine is an esolang made by Unname4798. == Command == Two commands only: [number] push [number]th bit of user input into the stack n pop two top bits, push NOR of two top bits After all instructions have been done, output all bits from top to bottom from
14:37:19 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150618&oldid=150210 * Unname4798 * (+33)
14:37:41 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150619&oldid=150618 * Unname4798 * (-3)
14:39:49 -!- Sgeo has joined.
14:52:55 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150620&oldid=150453 * Dmiz * (+0)
15:00:47 -!- Sgeo has quit (*.net *.split).
15:00:47 -!- amby has quit (*.net *.split).
15:00:48 -!- Guest6479 has quit (*.net *.split).
15:00:49 -!- moony has quit (*.net *.split).
15:00:49 -!- ski has quit (*.net *.split).
15:00:49 -!- APic has quit (*.net *.split).
15:05:45 -!- Sgeo has joined.
15:05:45 -!- amby has joined.
15:05:45 -!- Guest6479 has joined.
15:05:45 -!- moony has joined.
15:05:45 -!- ski has joined.
15:05:45 -!- APic has joined.
15:06:58 -!- amby has quit (Write error: Connection reset by peer).
15:07:15 -!- amby has joined.
15:21:22 <esolangs> [[Smasnug]] N https://esolangs.org/w/index.php?oldid=150621 * Win7HE * (+593) Created page with "== smasnug == smasnug is created by [[User:Win7HE]] just [[HQ9+]] but with [o]utput and [i]nput and / division and [3] accumulators == the new smaooong commands == o = outputs accumulator #2 i = puts 1 character input (in decimal) in accumulator #3 / = divides accu. 1 by
15:21:44 <esolangs> [[Smasnug]] https://esolangs.org/w/index.php?diff=150622&oldid=150621 * Win7HE * (+5)
15:24:07 <esolangs> [[User:Win7HE]] https://esolangs.org/w/index.php?diff=150623&oldid=149476 * Win7HE * (+52) /* check out these */
15:27:50 <esolangs> [[HQ9+]] https://esolangs.org/w/index.php?diff=150624&oldid=142700 * Win7HE * (+34) /* See also */
15:38:56 -!- chomwitt has joined.
15:50:32 -!- tromp has joined.
15:52:43 <esolangs> [[HQ9+]] https://esolangs.org/w/index.php?diff=150625&oldid=150624 * Somefan * (-1)
16:22:01 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150626&oldid=150611 * DGCK81LNN * (-645)
16:28:34 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:30:13 -!- m5zs7k has quit (Ping timeout: 248 seconds).
16:32:54 -!- m5zs7k has joined.
16:52:32 -!- tromp has joined.
18:24:19 <esolangs> [[Every-machine]] https://esolangs.org/w/index.php?diff=150627&oldid=134908 * Unname4798 * (+207)
18:25:28 <esolangs> [[Every-machine]] https://esolangs.org/w/index.php?diff=150628&oldid=150627 * Unname4798 * (+44)
18:34:50 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150629&oldid=150579 * Aadenboy * (+57) /* Commands */ forgot this command
18:43:07 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150630&oldid=150629 * Aadenboy * (+588) /* Examples */ implement subtraction
18:43:58 -!- Lord_of_Life_ has joined.
18:44:05 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150631&oldid=150630 * Aadenboy * (+49) /* A-B */
18:44:47 -!- Lord_of_Life has quit (Ping timeout: 252 seconds).
18:45:56 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150632&oldid=150631 * Aadenboy * (-12) /* A-B */
18:46:52 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:50:31 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150633&oldid=150632 * Aadenboy * (+35)
18:51:06 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150634&oldid=150633 * Aadenboy * (+0) /* A-B */
19:12:28 <esolangs> [[Chops]] M https://esolangs.org/w/index.php?diff=150635&oldid=150100 * Buckets * (+12)
19:13:04 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150636&oldid=150303 * Buckets * (+12)
19:13:53 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150637&oldid=150636 * Buckets * (+17)
19:20:56 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=150638&oldid=150504 * Buckets * (+9)
19:30:12 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=150639&oldid=150260 * 47 * (-139) /* Other things */
19:35:58 <esolangs> [[11]] M https://esolangs.org/w/index.php?diff=150640&oldid=148919 * Buckets * (+310)
19:43:07 <esolangs> [[User:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=150641&oldid=148429 * 47 * (+275) /* commands */
19:45:28 <esolangs> [[Snakel/Compatibility methods]] https://esolangs.org/w/index.php?diff=150642&oldid=150455 * 47 * (-869) nevermind
19:46:57 <esolangs> [[Snakel/Syntax]] https://esolangs.org/w/index.php?diff=150643&oldid=149469 * 47 * (-3345) nevermind
19:48:29 <esolangs> [[Snakel/Errors]] https://esolangs.org/w/index.php?diff=150644&oldid=147804 * 47 * (-2329) you get it already
19:52:16 <esolangs> [[Snakel]] https://esolangs.org/w/index.php?diff=150645&oldid=147791 * 47 * (+6276) so uh...
19:54:00 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=150646&oldid=149341 * 47 * (-1) now classes do not need an implicit space
19:59:36 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=150647&oldid=150646 * 47 * (-152) more stuff
20:00:11 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=150648&oldid=150647 * 47 * (+31)
20:12:12 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150649&oldid=150634 * Aadenboy * (+367)
20:15:59 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150650&oldid=150308 * 47 * (+2) /* The commands */
20:18:36 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150651&oldid=150637 * Buckets * (+19)
20:20:48 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150652&oldid=150651 * Buckets * (+9)
20:23:13 <esolangs> [[Switch gr]] https://esolangs.org/w/index.php?diff=150653&oldid=150650 * 47 * (+472) /* Examples */
20:24:04 <esolangs> [[Sipes]] M https://esolangs.org/w/index.php?diff=150654&oldid=150652 * Buckets * (+0)
20:42:56 -!- chomwitt has quit (Ping timeout: 272 seconds).
21:15:46 -!- chiselfuse has quit (Remote host closed the connection).
21:16:08 -!- chiselfuse has joined.
21:21:46 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:29:13 -!- Sgeo has quit (Read error: Connection reset by peer).
21:29:16 -!- Sgeo_ has joined.
21:51:28 -!- tromp has joined.
22:23:45 -!- Everything has joined.
22:32:26 <esolangs> [[Print("Hello, World!")]] https://esolangs.org/w/index.php?diff=150655&oldid=150228 * Ractangle * (-2) /* G Sharp */
22:33:39 <esolangs> [[Empty Program]] https://esolangs.org/w/index.php?diff=150656&oldid=148168 * Ractangle * (-1) /* G# */
22:34:40 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=150657&oldid=150648 * Ractangle * (-10) /* Infinite loop */
22:37:01 <esolangs> [[G Sharp]] https://esolangs.org/w/index.php?diff=150658&oldid=150657 * Ractangle * (-60) /* 99 bottles of beer */
22:37:31 <esolangs> [[99 bottles of beer]] https://esolangs.org/w/index.php?diff=150659&oldid=150599 * Ractangle * (-389) /* */
22:38:54 <esolangs> [[99 bottles of beer]] https://esolangs.org/w/index.php?diff=150660&oldid=150659 * Ractangle * (-178) /* G# */
22:40:28 -!- Everything has quit (Ping timeout: 265 seconds).
22:47:06 -!- Everything has joined.
22:55:11 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150661&oldid=150626 * DGCK81LNN * (+1049)
22:57:29 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150662&oldid=150661 * DGCK81LNN * (+18) /* Koishi runtime specific */
23:03:11 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:09:46 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150663&oldid=150662 * DGCK81LNN * (+1014) /* Koishi runtime specific */
23:10:24 -!- chiselfuse has quit (Ping timeout: 264 seconds).
23:12:03 -!- chiselfuse has joined.
23:25:07 -!- Everything has quit (Quit: Lost terminal).
23:34:48 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150664&oldid=150663 * DGCK81LNN * (+0)
23:38:53 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150665&oldid=150664 * DGCK81LNN * (+36) /* Practices and idioms */
23:39:30 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150666&oldid=150665 * DGCK81LNN * (-91) /* Practices and idioms */
23:51:16 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150667&oldid=150666 * DGCK81LNN * (+273) /* Practices and idioms */
23:53:11 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150668&oldid=150667 * DGCK81LNN * (+19) /* Practices and idioms */
23:54:03 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150669&oldid=150668 * DGCK81LNN * (+1) /* Practices and idioms */
23:56:24 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150670&oldid=150669 * DGCK81LNN * (+9) /* Example programs */
23:57:27 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150671&oldid=150670 * DGCK81LNN * (+15) /* Koishi runtime specific */
00:21:35 <esolangs> [[User:Ashli Katt]] M https://esolangs.org/w/index.php?diff=150672&oldid=133092 * Ashli Katt * (-80)
00:41:54 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150673&oldid=150671 * Jan jelo * (+173) /* Practices and idioms */
00:42:53 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150674&oldid=150673 * Jan jelo * (+11) /* Practices and idioms */
00:58:26 -!- xelxebar_ has joined.
01:04:28 -!- xelxebar has quit (Quit: ZNC 1.7.2+deb3 - https://znc.in).
01:04:29 -!- FreeFull has quit (Remote host closed the connection).
01:04:36 -!- FreeFull has joined.
01:17:19 <esolangs> [[Talk:Iterate]] https://esolangs.org/w/index.php?diff=150675&oldid=150551 * PkmnQ * (+312)
01:49:27 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:00:04 -!- bgh has joined.
02:11:12 -!- moony has quit (Read error: Connection reset by peer).
02:11:41 -!- moony7 has joined.
02:16:24 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150676&oldid=150649 * Aadenboy * (+306) edge cases
02:17:16 -!- Guest6479 has quit (Ping timeout: 252 seconds).
02:17:25 -!- Ae` has joined.
02:34:19 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150677&oldid=150676 * Aadenboy * (+38) edge case
02:54:23 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150678&oldid=150615 * PrySigneToFry * (+871)
02:57:22 <esolangs> [[User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=150679&oldid=149554 * PrySigneToFry * (+78)
02:57:58 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150680&oldid=150600 * PrySigneToFry * (-1)
03:13:40 -!- yewscion has joined.
03:13:56 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150681&oldid=150677 * Aadenboy * (-226) /* A-B */ better subtraction algorithm
03:18:30 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150682&oldid=150681 * Aadenboy * (+103) implemented
03:23:41 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150683&oldid=150674 * Jan jelo * (+359) /* Example programs */
03:24:05 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150684&oldid=150683 * Jan jelo * (-4) /* Example programs */
03:24:32 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150685&oldid=150684 * Jan jelo * (-11) /* Example programs */
03:29:11 <esolangs> [[WhatLang]] M https://esolangs.org/w/index.php?diff=150686&oldid=150685 * Jan jelo * (-5) /* Example programs */ oh,I can use arr@
03:40:31 -!- Sgeo_ has quit (Read error: Connection reset by peer).
03:42:35 -!- Sgeo has joined.
03:53:35 -!- bgh has quit (Quit: Client closed).
04:01:15 -!- craigo has quit (Quit: Leaving).
04:40:38 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150687&oldid=150534 * MihaiEso * (+500) /* X-script 3.1? */
04:43:33 -!- yewscion_ has joined.
04:46:04 -!- yewscion has quit (Ping timeout: 260 seconds).
05:23:31 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150688&oldid=150682 * Aadenboy * (+6) /* A-B */
05:35:57 <esolangs> [[Esolang:Introduce yourself]] M https://esolangs.org/w/index.php?diff=150689&oldid=150533 * Ellos * (+151) /* Introductions */
06:18:50 <esolangs> [[X-script/Examples]] https://esolangs.org/w/index.php?diff=150690&oldid=150592 * PrySigneToFry * (+67)
06:23:29 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150691&oldid=150687 * PrySigneToFry * (+987)
06:30:52 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150692&oldid=150613 * Jan jelo * (+295) /* QWOP */
06:32:05 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150693&oldid=150692 * Jan jelo * (-296) /* Smalltalk */ wait,I read it wrong
06:32:54 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150694&oldid=150693 * Jan jelo * (+295) /* Smalltalk */
06:34:26 <esolangs> [[Anti-Plushie language/PSTF]] https://esolangs.org/w/index.php?diff=150695&oldid=150036 * PrySigneToFry * (-237)
06:36:50 <esolangs> [[PrySigneToFry-complete]] https://esolangs.org/w/index.php?diff=150696&oldid=150236 * PrySigneToFry * (+70)
07:11:29 -!- yewscion_ has quit (Read error: Connection reset by peer).
07:30:40 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150697&oldid=150678 * Ractangle * (-5) we fix spelling
07:32:21 <esolangs> [[User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=150698&oldid=150679 * Ractangle * (+225) /* To get code-golfing, I recommend to use the Base-100. */
07:33:37 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150699&oldid=150680 * Ractangle * (+5)
07:54:39 -!- tromp has joined.
08:10:07 -!- Sgeo has quit (Read error: Connection reset by peer).
08:13:26 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150700&oldid=150694 * Jan jelo * (+108) /* DUP */
08:19:07 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150701&oldid=150697 * I am islptng * (+13) /* LifeWiki is down! */
08:20:13 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150702&oldid=150700 * Jan jelo * (+168) /* Lisp */
09:40:04 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
10:44:24 -!- tromp has joined.
10:46:03 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150703&oldid=150702 * Jan jelo * (-4745) /* Brainfuck */ replace into a shorter one
11:39:36 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150704&oldid=150595 * PrySigneToFry * (+49)
12:04:26 -!- mtm has quit (Ping timeout: 272 seconds).
12:04:51 -!- V has joined.
12:06:12 -!- mtm has joined.
12:56:34 <esolangs> [[Talk:List of quines]] https://esolangs.org/w/index.php?diff=150705&oldid=117628 * Blashyrkh * (+268) Some doubts about Subleq quine
12:59:48 -!- visilii has quit (Read error: Connection reset by peer).
13:01:07 -!- visilii has joined.
13:06:08 <esolangs> [[Talk:List of quines]] https://esolangs.org/w/index.php?diff=150706&oldid=150705 * Blashyrkh * (+91) /* Subleq */
13:19:46 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150707&oldid=150703 * Blashyrkh * (+2846) /* Real Quines */ Lazy K quine, implemented a couple of years ago
13:38:30 -!- Everything has joined.
13:40:25 -!- chomwitt has joined.
13:41:55 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150708&oldid=150707 * Jan jelo * (-1707) /* Brainfuck */ replace it into a shorter one
13:48:59 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150709&oldid=150176 * Blashyrkh * (+184)
13:58:22 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150710&oldid=150709 * Jan jelo * (+26) /* Brainfuck quine */
14:06:24 <esolangs> [[User talk:Jan jelo]] https://esolangs.org/w/index.php?diff=150711&oldid=150710 * Blashyrkh * (+112) /* Brainfuck quine */
14:06:57 <esolangs> [[User talk:Jan jelo]] M https://esolangs.org/w/index.php?diff=150712&oldid=150711 * Jan jelo * (+7) /* Brainfuck quine */
14:13:07 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=150713&oldid=150708 * Jan jelo * (+33) /* Brainfuck */
14:13:42 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=150714&oldid=150713 * Jan jelo * (-1) /* Brainfuck */
14:16:33 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=150715&oldid=150714 * Jan jelo * (-4) /* Brainfuck */
14:22:26 -!- amby has joined.
15:11:50 <esolangs> [[User:B jonas]] https://esolangs.org/w/index.php?diff=150716&oldid=147561 * B jonas * (+6) /* Games that the esolangs community plays */
15:35:02 -!- Sgeo has joined.
15:46:37 <esolangs> [[List of quines]] M https://esolangs.org/w/index.php?diff=150717&oldid=150715 * Jan jelo * (+95) /* Bash */
16:19:40 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:21:19 -!- tromp has joined.
16:21:49 -!- chomwitt has quit (Remote host closed the connection).
16:52:18 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150718&oldid=150688 * Aadenboy * (+1215) /* Basic arithmetic */ implement modulus
17:01:29 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150719&oldid=150718 * Aadenboy * (+656) /* Basic arithmetic */ implement floored division
17:01:54 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150720&oldid=150719 * Aadenboy * (+11) /* A/B */
17:22:33 -!- Everything has quit (Ping timeout: 252 seconds).
17:42:15 <korvo> Oh, okay, I see how to parse BIIA? in one pass. With lots of reallocation or slicing/indexing arithmetic. Not worth it.
17:52:39 -!- craigo has joined.
18:00:53 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=150721&oldid=149937 * 47 * (+153) /* Syntax */
18:01:11 <esolangs> [[Marb]] https://esolangs.org/w/index.php?diff=150722&oldid=150721 * 47 * (-2) /* Truth-machine */
18:02:09 <esolangs> [[List of ideas]] https://esolangs.org/w/index.php?diff=150723&oldid=148876 * B jonas * (+465) /* Ideas for Names */ ambiguous classical mythology names
18:04:12 <b_jonas> korvo: you can use one of the union tree structures in CLRS to find the connected components in one pass, but it's indeed not worth because parsing is just a small part of running a BIIA program so the rest of the execution will overshadow it in resource costs anyway.
18:05:04 <korvo> b_jonas: Sure. What I'm finding is that the allocation of each tile's storage needs to be bounded, and so I need a pass to compute the bounds before I can start copying into the tile. The graph traversal is indeed a very slick way to get that first pass done.
18:06:18 <b_jonas> you could also borrow a Piet parser for this
18:06:26 <b_jonas> since that identifies connected components as well
18:11:09 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:11:53 <korvo> I'm set. Next step is to figure out non-interactive execution, starting with cases without I/O.
18:26:04 <esolangs> [[Anti-Plushie language]] M https://esolangs.org/w/index.php?diff=150724&oldid=142465 * Aadenboy * (+97)
18:26:19 <esolangs> [[Anti-Plushie language]] M https://esolangs.org/w/index.php?diff=150725&oldid=150724 * Aadenboy * (+3)
18:38:10 -!- tromp has joined.
18:45:25 -!- Lord_of_Life has quit (Ping timeout: 244 seconds).
18:50:06 -!- Lord_of_Life has joined.
19:29:13 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:31:47 -!- tromp has joined.
19:41:56 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
19:44:00 -!- tromp has joined.
19:45:15 <korvo> Oh, non-interactive execution is just graph search. So interactive BIIA? should be mere interleaving of search with I/O, with output only -- uh, I guess I need terms.
19:46:25 <korvo> A *corner* will be a partial witness rectangle, filled in at (0,0), with no empty spaces in its interior. A *corner tile* has (0,0) filled in.
19:47:23 <korvo> So, search can be decomposed into discrete sets of corners, starting with the set of corner tiles. Then I/O should be possible whenever the current set of corners all agree on the output.
19:47:57 <korvo> To make that interactive, merely constrain the search relative to current input, and make the output relative to some initial segment of already-emitted output.
19:48:42 <korvo> Like, we can imagine a graph whose vertices are corners and whose edges are labeled by tiles; an edge labeled with tile T indicates that T can be fitted to the source corner to form the target corner.
19:49:11 <korvo> And then execution is merely graph search, looking for at least one corner which is a witness. The given semantics don't really allow for anything simpler.
19:49:56 <int-e> "not worth it" - funnily enough I implement disjoint set forests relatively often because I think they're simple. (I'll do it in Haskell and pay the log(n) overhead from using persistent data structures instead of arrays)
19:50:58 <b_jonas> int-e: sure, but I'm saying specifically for But is it art
19:52:03 <int-e> b_jonas: Yeah I have no point. Except maybe that there's more than one cost metric.
19:52:39 <int-e> It's more of a tangent while I'm reminding myself what the semantics of BIIA are.
19:58:10 <korvo> Ugh, I'm going to have to write an event loop if I want to do this from RPython. Debating whether to reuse the libuv bindings I wrote a while ago or hack up something that only handles stdio.
19:58:57 <korvo> ...Or I could just put stdin into non-blocking mode. What's the worst that could happen~
20:04:30 <int-e> (Ugh those semantics are awful :P I mean, from the perspective of actually trying to implement them.)
20:07:16 -!- yewscion has joined.
20:14:09 <int-e> b_jonas: And the reason why I don't think that it's overkill is because when scanning input linearly, you can have some pretty complicated intermediate connectivity relations that eventually collapse into a single component. https://paste.debian.net/1346663/ But indeed... this is just for parsing and that's not the difficult part.
20:17:52 <korvo> ...Wait, are tiles allowed to be non-convex? I wasn't sure.
20:18:42 <int-e> I /assume/ that they can also have holes
20:18:52 <int-e> all the spec says is that they're connected
20:19:04 <int-e> (and since holes are finite you can assume that there aren't any w.l.o.g.
20:19:58 <int-e> (you can pre-fill them; that may result in exponentially more tiles)
20:20:42 <korvo> Couldn't that require pre-computing all possible inputs? "Exponentially" sounds like a real issue.
20:21:22 <int-e> No, this is pure preprocessing.
20:21:27 <int-e> No input is involved yet.
20:22:29 <esolangs> [[Egel]] https://esolangs.org/w/index.php?diff=150726&oldid=94234 * B jonas * (+1034) Example programs
20:22:53 <int-e> You parse all tiles. Then, for each tile with a hole, you fill the hole in all possible ways and use the resulting unholey tiles instead.
20:23:48 <int-e> For implementations that try to be practical as much as possible this is probably a terrible idea of course.
20:25:13 <korvo> Yeah. Still, I see what you're saying about the theory. I suppose I could assume for now that there aren't any holes, and then add that preprocessing later on.
20:25:50 <korvo> But it would multiply everything by a number of tiles, when instead the holes could be like mini-constraints with their own mini-clauses to satisfy.
20:26:27 <korvo> It's analogous to pre-computing tables for grammars, knowing that often it's possible to pre-compute one more layer by multiplying everything by some uncomfortably large constant.
20:26:58 <korvo> (Where "uncomfortably large" is around 1.01 or so? And in practice computer science requires it to be at least 2, which is terrifying.)
20:37:18 <int-e> Oh nice. It's not all that hard to prove that that compositeness test works.
20:44:11 <int-e> (Idea: Relabel the tiles as follows, https://paste.debian.net/1346669/ and then reason from the bottom that any rectangle you fill will be a 3n x 2m rectangle. Then look at the top right to see that n,m > 1.)
20:46:34 <int-e> (Each eb/+++ belongs to a separate tile; the ambiguity is limited to whether the - characters connect to the top or to the right and bottom.)
20:47:27 <int-e> err, or to the left
21:21:12 <esolangs> [[List of ideas]] https://esolangs.org/w/index.php?diff=150727&oldid=150723 * Ractangle * (+133) /* Ideas for Names */
21:27:22 -!- bgh has joined.
21:30:32 -!- bgh has left.
21:39:25 <esolangs> [[Counterlang]] https://esolangs.org/w/index.php?diff=150728&oldid=150572 * Kaveh Yousefi * (+37) Rectified the Extended Backus-Naur Form (EBNF) description in order to admit counter names as subtrahends.
21:50:11 <int-e> Oh and I guess this also shows that we can drop the middle column from all tiles and it still works (one needs to shift the 'eb' part too).
21:58:13 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150729&oldid=150550 * Calculus is fun * (-2) /* 99 bottles of beer */
22:26:43 <esolangs> [[D.U.C.K.]] M https://esolangs.org/w/index.php?diff=150730&oldid=108082 * Calculus is fun * (+0) black whole -> black hole
22:34:35 -!- DOS_User_webchat has joined.
22:36:57 <esolangs> [[A+B Problem]] M https://esolangs.org/w/index.php?diff=150731&oldid=150610 * Aadenboy * (+40) /* Iterate */ update
22:44:58 -!- DOS_User_webchat has quit (Remote host closed the connection).
23:23:49 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
23:32:50 <esolangs> [[TimeWaste]] M https://esolangs.org/w/index.php?diff=150732&oldid=106654 * TheCanon2 * (+29) Turing completeness ignores delays
00:03:54 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150733&oldid=150729 * Calculus is fun * (+223) Added small tip for run
00:03:56 -!- mtm has quit (Ping timeout: 265 seconds).
00:05:57 -!- mtm has joined.
01:10:24 -!- ais523 has joined.
01:47:25 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:49:23 -!- ManDeJan has quit (Server closed connection).
03:49:30 -!- ManDeJan has joined.
03:59:29 -!- yewscion_ has joined.
04:01:57 -!- yewscion has quit (Ping timeout: 248 seconds).
04:03:32 -!- craigo has quit (Quit: Leaving).
04:03:46 <esolangs> [[Iterate]] https://esolangs.org/w/index.php?diff=150734&oldid=150720 * Aadenboy * (+1128) /* Basic arithmetic */ implement conditional
04:06:17 <esolangs> [[Talk:Iterate]] https://esolangs.org/w/index.php?diff=150735&oldid=150675 * Aadenboy * (+547)
04:13:03 <esolangs> [[Iterate]] M https://esolangs.org/w/index.php?diff=150736&oldid=150734 * Aadenboy * (+113) /* Conditionals */ move the ==0 check to the top for edge cases
05:21:10 <korvo> Oh. TIL that the algorithm I figured out in university for fitting Tetris pieces is not sufficiently general to fit BIIA? tiles. Obvious in retrospect.
05:21:48 <korvo> Currently trying to figure out how to know when a tile could be a reasonable candidate for fitting at a specific location, and all of the nice induction I built up for corners doesn't hold for arbitrary tiles.
05:23:04 <korvo> Nor do tiles have to admit any sort of nice extent or boundary. So I have to think about the case where a very wide/long tile is mixed with a lot of tiny tiles and avoid building overly-long candidates that can't be filled in.
05:26:30 <esolangs> [[Lento]] https://esolangs.org/w/index.php?diff=150737&oldid=89528 * Somefan * (+47)
05:45:53 -!- ursa-major has quit (Server closed connection).
05:46:02 -!- ursa-major has joined.
05:49:26 <esolangs> [[Anti-Plushie language]] https://esolangs.org/w/index.php?diff=150738&oldid=150725 * PrySigneToFry * (+136)
05:52:43 -!- nitrix has quit (Quit: ZNC 1.8.2 - https://znc.in).
05:53:52 -!- nitrix has joined.
05:54:15 <ais523> BIIA? is surprisingly difficult to implement for being such a "simple" language
05:55:06 <ais523> fwiw, my thoughts on parsing it involved a union-find data structure; you could actually parse it very simply via simply scanning line by line and adding each nonempty character to the same union as the adjacent ones
05:55:35 <ais523> but that doesn't help much with the fitting step, which is the hard one and one I don't know how to implement efficiently
05:58:18 <esolangs> [[X-script]] https://esolangs.org/w/index.php?diff=150739&oldid=150704 * PrySigneToFry * (+574)
06:08:01 <korvo> Conceptually, the major difficulty is that the witness search must be complete. If I were allowed to half-ass it, then it'd be easy to write an unfair search that almost never succeeds.
06:09:32 <korvo> I like the union-find insight. It's much cleaner than what I did; I copied the input to a `bytearray`, a secret Python class that is like `str` but allows mutation, and then I blank out each tile after I find it. So I don't have to worry about whether I've already seen some part of some other tile.
06:14:29 -!- nitrix has quit (Quit: ZNC 1.8.2 - https://znc.in).
06:15:50 -!- nitrix has joined.
06:26:43 <ais523> korvo: I think your algorithm is linear-time, isn't it? as long as you scan in order and blank each tile the moment you find the first character within it
06:27:04 <ais523> because each cell is examined at most six times (once when scanning, once when blanking, and four times when blanking its neighbours)
06:27:45 <korvo> ais523: Yes, the outer loops are definitely bounded and run once over the indices of the array.
06:27:58 <ais523> so despite being a bit less elegant it might actually be faster, depending on the relative overheads of the two approaches
06:28:00 * korvo tends to trade space for time
06:54:38 <esolangs> [[x RGB8 panel]] N https://esolangs.org/w/index.php?oldid=150740 * Unname4798 * (+659) Created page with "^ RGB8 panel is an esolang created by Unname4798 in response to [[16x16 RGB2 panel]] == Commands == <pre> + increment - decrement > right < left / increment dimension the pointer is moving in \ decrement dimension the pointer is moving in [ when the selected cell
06:55:33 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150741&oldid=150619 * Unname4798 * (+42)
06:56:29 <esolangs> [[x RGB8 panel]] https://esolangs.org/w/index.php?diff=150742&oldid=150740 * Unname4798 * (+36)
06:58:07 <esolangs> [[x RGB8 panel]] https://esolangs.org/w/index.php?diff=150743&oldid=150742 * Unname4798 * (+49)
06:58:47 <esolangs> [[Special:Log/move]] move * Unname4798 * moved [[x RGB8 panel]] to [[^ RGB8 panel]]
06:59:04 <esolangs> [[User:Unname4798]] M https://esolangs.org/w/index.php?diff=150746&oldid=150741 * Unname4798 * (+0)
06:59:23 <esolangs> [[x RGB8 panel]] https://esolangs.org/w/index.php?diff=150747&oldid=150745 * Unname4798 * (-32) Blanked the page
07:02:18 <esolangs> [[^ RGB8 panel]] https://esolangs.org/w/index.php?diff=150748&oldid=150744 * Unname4798 * (+146)
07:03:09 <esolangs> [[^ RGB8 panel]] https://esolangs.org/w/index.php?diff=150749&oldid=150748 * Unname4798 * (-88)
07:22:55 <esolangs> [[^ RGB8 panel]] https://esolangs.org/w/index.php?diff=150750&oldid=150749 * Unname4798 * (+33)
07:24:26 <esolangs> [[^ RGB8 panel]] https://esolangs.org/w/index.php?diff=150751&oldid=150750 * Unname4798 * (+39)
07:27:52 <esolangs> [[Binary License Plate Language]] https://esolangs.org/w/index.php?diff=150752&oldid=148804 * Unname4798 * (-93)
07:28:24 -!- yewscion_ has quit (Read error: Connection reset by peer).
07:30:14 -!- yewscion_ has joined.
07:30:14 -!- yewscion_ has quit (Remote host closed the connection).
07:58:30 -!- tromp has joined.
08:15:30 <esolangs> [[User talk:Yayimhere]] https://esolangs.org/w/index.php?diff=150753&oldid=147105 * PrySigneToFry * (+1108) /* Will you contribute to my X-script? */ new section
08:49:53 -!- FreeFull has quit (Server closed connection).
08:50:03 -!- FreeFull has joined.
10:01:53 -!- Ae` has quit (Server closed connection).
10:02:03 -!- Ae` has joined.
10:59:01 <esolangs> [[Amo gus]] https://esolangs.org/w/index.php?diff=150754&oldid=148112 * PrySigneToFry * (+208)
11:19:33 <esolangs> [[Amo gus]] https://esolangs.org/w/index.php?diff=150755&oldid=150754 * PrySigneToFry * (+0)
11:23:24 -!- Sgeo has quit (Read error: Connection reset by peer).
11:25:39 <esolangs> [[Amo gus]] https://esolangs.org/w/index.php?diff=150756&oldid=150755 * PrySigneToFry * (+3)
11:45:42 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] N https://esolangs.org/w/index.php?oldid=150757 * Blashyrkh * (+2666) Kolakoski sequence in Brainfuck with logarithmic memory consumption, with comments
11:51:52 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150758&oldid=150452 * Blashyrkh * (+504) /* brainfuck */ Another brainfuck example, now with o(log n) memory consumption
11:55:21 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150759&oldid=150757 * Blashyrkh * (+2)
11:59:10 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150760&oldid=150759 * Blashyrkh * (+149) /* Kolakoski sequence generation implemented in Brainfuck with logarithmic memory consumption */
12:01:07 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
12:02:26 -!- mtm has quit (Ping timeout: 248 seconds).
12:06:56 -!- mtm has joined.
12:08:47 <esolangs> [[Amo gus]] https://esolangs.org/w/index.php?diff=150761&oldid=150756 * PrySigneToFry * (+0)
12:13:13 -!- tromp has joined.
12:18:51 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150762&oldid=148488 * 47 * (+1) /* Syntax */
12:19:45 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150763&oldid=150762 * 47 * (+0) /* Examples */
12:19:58 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150764&oldid=150763 * 47 * (-18) /* Syntax */
12:23:03 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150765&oldid=150764 * 47 * (+45) /* Interpreter */
12:24:25 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150766&oldid=150765 * 47 * (-1) /* Hello, world! */
12:24:41 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150767&oldid=150766 * 47 * (+0) /* Interpreter */
12:25:52 <esolangs> [[Amo gus]] https://esolangs.org/w/index.php?diff=150768&oldid=150761 * PrySigneToFry * (-7)
12:28:29 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=150769&oldid=150767 * 47 * (-6) /* Hello, world! */
12:30:21 <esolangs> [[Hello world program in esoteric languages (H-M)]] https://esolangs.org/w/index.php?diff=150770&oldid=149827 * 47 * (-7) /* How dare you fuck the brain */
12:33:18 <esolangs> [[Talk:SLet]] https://esolangs.org/w/index.php?diff=150771&oldid=150616 * PrySigneToFry * (+910)
12:34:28 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150772&oldid=150760 * Blashyrkh * (+216) Few thoughts about further enhancements
12:48:30 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
13:25:11 <esolangs> [[Zyxonia]] N https://esolangs.org/w/index.php?oldid=150773 * PrySigneToFry * (+5721) Created page with "Zyxonia(pronounced /ziksni/) is an Esolang designed by PSTF. = Language Overview = Zyxonia is a quasi-assembly, high-level, and powerful programming language. It uses an easy-to-understand but cumbersome syntax, and is capable of writing extremely powerful progra
13:25:52 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150774&oldid=150638 * PrySigneToFry * (+14)
13:42:08 <esolangs> [[User:YufangTSTSU/sandbox]] https://esolangs.org/w/index.php?diff=150775&oldid=148658 * YufangTSTSU * (-1982) Blanked the page
13:49:52 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=150776&oldid=150436 * 47 * (-993) welp. i am rebranding array into unai
14:03:40 -!- tromp has joined.
14:33:20 -!- amby has joined.
14:59:48 -!- DOS_User_webchat has joined.
15:02:23 <esolangs> [[Special:Log/upload]] upload * AdjectiveNounNumber * uploaded "[[File:When start.png]]"
15:07:59 -!- DOS_User_webchat has changed hostmask to ~DOS_User_@user/DOS-User-webchat:37962.
15:14:18 <esolangs> [[Special:Log/upload]] upload * AdjectiveNounNumber * uploaded "[[File:Define object, variable varname.png]]"
15:15:46 <esolangs> [[Spellblocks]] N https://esolangs.org/w/index.php?oldid=150779 * AdjectiveNounNumber * (+793) Created page with "Spellblocks is an [[esoteric programming language]] simiar to [https://scratch.mit.edu/ Scratch] created by [[User:AdjectiveNounNumber]] (me!) on January 25, 2025 ET. very WIP {| class="wikitable" |+ Blocks |- ! Block Name !! Description !! Scratch Repre
15:29:48 -!- molson_ has joined.
15:29:56 <esolangs> [[Small]] M https://esolangs.org/w/index.php?diff=150780&oldid=133140 * TheCanon2 * (+401)
15:32:33 -!- molson has quit (Ping timeout: 248 seconds).
15:33:14 -!- chomwitt has joined.
15:41:46 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
15:46:14 -!- tromp has joined.
15:55:02 -!- DOS_User_webchat has quit (Remote host closed the connection).
16:00:35 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
16:06:21 -!- tromp has joined.
17:11:11 -!- Thelie has joined.
17:14:08 <esolangs> [[Fixed Repeating Output]] https://esolangs.org/w/index.php?diff=150781&oldid=139859 * 47 * (-14) /* How dare you fuck the brain */
17:39:15 <esolangs> [[Fixed Repeating Output]] https://esolangs.org/w/index.php?diff=150782&oldid=150781 * Aadenboy * (+96) /* Implementations */ add [[Iterate]]
17:40:33 -!- chomwitt has quit (Ping timeout: 248 seconds).
17:58:46 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:18:15 -!- tromp has joined.
18:25:54 -!- DOS_User_webchat has joined.
18:26:20 -!- DOS_User_webchat has changed hostmask to ~DOS_User_@user/DOS-User-webchat:37962.
18:27:31 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:27:57 -!- DOS_User has joined.
18:28:12 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
18:28:41 -!- DOS_User has quit (Remote host closed the connection).
18:29:40 -!- DOS_User_webchat has joined.
18:31:06 -!- DOS_User_webchat has changed nick to DOS_User.
18:31:32 -!- DOS_User has changed nick to DOS_User_webchat.
18:31:52 -!- DOS_User_webchat has quit (Remote host closed the connection).
18:46:04 -!- Lord_of_Life has quit (Ping timeout: 252 seconds).
18:46:05 -!- Lord_of_Life_ has joined.
18:48:26 -!- tromp has joined.
18:49:01 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:59:09 <esolangs> [[BIIA]] N https://esolangs.org/w/index.php?oldid=150783 * B jonas * (+28) Redirected page to [[But Is It Art?]]
19:16:13 -!- ais523 has quit (Quit: quit).
19:47:07 -!- craigo has joined.
19:54:45 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:08:47 -!- tromp has joined.
20:22:17 -!- Lord_of_Life has quit (Remote host closed the connection).
20:28:14 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
20:39:49 -!- tromp has joined.
20:44:17 -!- Thelie has quit (Quit: Leaving.).
20:45:07 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] https://esolangs.org/w/index.php?diff=150784&oldid=150772 * Blashyrkh * (-351) Shorter version
20:46:16 <esolangs> [[Kolakoski sequence]] https://esolangs.org/w/index.php?diff=150785&oldid=150758 * Blashyrkh * (-24) /* brainfuck */ Shorter version
20:49:49 <esolangs> [[Kolakoski sequence]] M https://esolangs.org/w/index.php?diff=150786&oldid=150785 * Blashyrkh * (+28) /* brainfuck */
20:59:38 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150787&oldid=150784 * Blashyrkh * (+203)
21:01:16 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150788&oldid=150787 * Blashyrkh * (-203) Undo revision [[Special:Diff/150787|150787]] by [[Special:Contributions/Blashyrkh|Blashyrkh]] ([[User talk:Blashyrkh|talk]])
21:13:02 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
21:30:24 -!- Sgeo has joined.
21:32:51 -!- chomwitt has joined.
22:07:18 -!- chomwitt has quit (Ping timeout: 265 seconds).
22:12:04 <esolangs> [[Definition]] https://esolangs.org/w/index.php?diff=150789&oldid=149395 * Ractangle * (+138)
22:18:37 -!- amby has quit (Remote host closed the connection).
22:19:20 -!- amby has joined.
22:21:34 -!- amby has quit (Read error: Connection reset by peer).
22:24:24 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=150790&oldid=150733 * Calculus is fun * (+536) Infinity is a thing now, cool!
22:27:11 -!- amby has joined.
22:27:34 -!- ajal has joined.
22:30:56 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150791&oldid=150790 * Calculus is fun * (+122) Added hyperStep
22:31:27 -!- amby has quit (Ping timeout: 244 seconds).
22:32:09 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150792&oldid=150791 * Calculus is fun * (+1) /* Infinity */
22:32:39 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150793&oldid=150792 * Calculus is fun * (-1) /* Standard operations */
22:35:36 -!- ajal has quit (Read error: Connection reset by peer).
22:53:52 -!- amby has joined.
23:27:12 <esolangs> [[Esolang talk:Categorization]] https://esolangs.org/w/index.php?diff=150794&oldid=147588 * Aadenboy * (+137) /* Category for esoteric supersets */ new section
23:27:33 <esolangs> [[Esolang talk:Categorization]] M https://esolangs.org/w/index.php?diff=150795&oldid=150794 * Aadenboy * (+287) /* Category for esoteric supersets */ whoops forgot to sign it
23:30:50 <esolangs> [[Esolang:Categorization]] M https://esolangs.org/w/index.php?diff=150796&oldid=150388 * Aadenboy * (+110) /* Miscellaneous */ list [[Category:Esoteric subset]]
23:37:40 -!- DOS_User_webchat has joined.
23:38:21 -!- DOS_User_webchat has changed hostmask to ~DOS_User_@user/DOS-User-webchat:37962.
23:48:21 -!- DOS_User_webchat has quit (Remote host closed the connection).
00:04:20 -!- mtm has quit (Ping timeout: 252 seconds).
00:06:05 -!- mtm has joined.
00:57:41 <esolangs> [[WrongFuck]] https://esolangs.org/w/index.php?diff=150797&oldid=128958 * Kaveh Yousefi * (+3964) Rectified the cat program, which bore its + and - symbols confounded, introduced a truth-machine example, and added conversion operations in the Common Lisp programming language betwixt WrongFuck and brainfuck.
01:00:23 <esolangs> [[WrongFuck]] M https://esolangs.org/w/index.php?diff=150798&oldid=150797 * Kaveh Yousefi * (+0) Rectified the formatting of the conversion functions.
01:25:39 -!- tromp has joined.
01:25:56 -!- tromp has quit (Client Quit).
01:49:35 <esolangs> [[User talk:Aadenboy]] https://esolangs.org/w/index.php?diff=150799&oldid=150585 * PrySigneToFry * (+52)
01:56:24 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=150800&oldid=150597 * Ais523 * (+198) /* Soft redirect */ can even use a hard redirect if it's in userspace
02:35:28 <esolangs> [[User:GUAqwq/brainfuck quine]] https://esolangs.org/w/index.php?diff=150801&oldid=140582 * GUAqwq * (-739)
02:35:47 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:49:18 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=150802&oldid=150460 * AdjectiveNounNumber * (+70)
02:51:32 <esolangs> [[0134]] https://esolangs.org/w/index.php?diff=150803&oldid=150596 * PrySigneToFry * (+97)
03:05:02 -!- op_4 has quit (Remote host closed the connection).
03:05:33 -!- op_4 has joined.
03:24:14 <esolangs> [[Stub]] https://esolangs.org/w/index.php?diff=150804&oldid=150565 * PrySigneToFry * (+190)
03:26:12 <esolangs> [[Stub]] M https://esolangs.org/w/index.php?diff=150805&oldid=150804 * Aadenboy * (+1) /* Hello, World! */
03:39:03 <esolangs> [[List of quines]] https://esolangs.org/w/index.php?diff=150806&oldid=150717 * Jan jelo * (+575) /* Brainfuck */ some explanations
05:01:05 -!- tromp has joined.
05:20:15 -!- tromp has quit (Quit: My iMac has gone to sleep. ZZZzzz…).
05:22:32 -!- tromp has joined.
05:25:58 -!- tromp has quit (Client Quit).
05:36:54 <esolangs> [[Stub]] https://esolangs.org/w/index.php?diff=150807&oldid=150805 * PrySigneToFry * (+0)
05:41:10 <esolangs> [[99 bottles of beer]] https://esolangs.org/w/index.php?diff=150808&oldid=150660 * WinslowJosiah * (+7022) Add 99BoB in Bespoke (it'd be lovely to turn this into "poetic" form, though)
05:41:32 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150809&oldid=150699 * PrySigneToFry * (+142)
05:45:14 <esolangs> [[A+B Problem]] https://esolangs.org/w/index.php?diff=150810&oldid=150731 * None1 * (-147)
05:45:48 <esolangs> [[Talk:A+B Problem]] https://esolangs.org/w/index.php?diff=150811&oldid=150540 * None1 * (+308)
07:01:07 -!- chomwitt has joined.
07:03:14 -!- craigo has quit (Ping timeout: 248 seconds).
07:12:01 -!- chomwitt has quit (Ping timeout: 265 seconds).
07:46:13 -!- chomwitt has joined.
08:09:05 <esolangs> [[Zyxonia/Compile]] N https://esolangs.org/w/index.php?oldid=150812 * PrySigneToFry * (+2324) Created page with "{{Back|Zyxonia}} Zyxonia uses a compiling system like C/C++. = How did it work? = It can roughly divided to 5 parts. == Part I: Clean == In the "clean" phase, Zyxonia deletes the comments and unused waste variables in the code, then expands all iteratio
08:11:30 <esolangs> [[Zyxonia]] https://esolangs.org/w/index.php?diff=150813&oldid=150773 * PrySigneToFry * (+47)
09:02:38 <esolangs> [[Talk:A+B Problem]] https://esolangs.org/w/index.php?diff=150814&oldid=150811 * Blashyrkh * (+383)
09:17:38 <esolangs> [[Special:Log/newusers]] create * Coobird * New user account
09:21:09 -!- Sgeo_ has joined.
09:21:23 -!- Sgeo has quit (Read error: Connection reset by peer).
09:29:11 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150815&oldid=150788 * Blashyrkh * (+122) /* Kolakoski sequence generation implemented in Brainfuck with logarithmic memory consumption */
09:46:06 <esolangs> [[Stub]] https://esolangs.org/w/index.php?diff=150816&oldid=150807 * Ractangle * (+0) you missed the joke
09:50:51 -!- Lord_of_Life has joined.
09:52:27 -!- Lord_of_Life has quit (Client Quit).
09:54:04 -!- Lord_of_Life has joined.
09:57:23 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=150817&oldid=150689 * Coobird * (+230) /* Introductions */
10:08:34 <esolangs> [[Brainfuck implementations]] https://esolangs.org/w/index.php?diff=150818&oldid=149335 * Coobird * (+325)
10:34:50 <esolangs> [[TM]] https://esolangs.org/w/index.php?diff=150819&oldid=113675 * I am islptng * (+234) Removed redirect to [[]]
10:36:28 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150820&oldid=150809 * I am islptng * (+17)
10:54:36 <esolangs> [[TM]] https://esolangs.org/w/index.php?diff=150821&oldid=150819 * I am islptng * (+130)
10:58:41 <esolangs> [[Poetic (family)]] https://esolangs.org/w/index.php?diff=150822&oldid=148455 * Unname4798 * (+13)
11:00:40 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150823&oldid=150701 * I am islptng * (+590) /* */
11:04:10 <esolangs> [[Poetic LOLWICNETP]] https://esolangs.org/w/index.php?diff=150824&oldid=142185 * Unname4798 * (-95)
11:15:47 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150825&oldid=150820 * Unname4798 * (+265)
11:16:25 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150826&oldid=150825 * Unname4798 * (+1) /* Type 29 */
11:17:49 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150827&oldid=150826 * Unname4798 * (+21)
11:20:40 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150828&oldid=150827 * Unname4798 * (+10)
11:25:40 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150829&oldid=150828 * Unname4798 * (+283) /* Type 29 */
11:30:25 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150830&oldid=150829 * I am islptng * (-580) Please ask PSTF or None1 to allow you to contribute, Unname4798!
11:37:21 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150831&oldid=150830 * Unname4798 * (-159) Everyone is now free to contribute !
11:37:58 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150832&oldid=150831 * Unname4798 * (+739) correcting the page
11:50:36 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150833&oldid=150823 * PrySigneToFry * (+914)
11:55:36 <esolangs> [[NOR Machine]] https://esolangs.org/w/index.php?diff=150834&oldid=150617 * PrySigneToFry * (+28)
12:04:27 -!- mtm has quit (Ping timeout: 252 seconds).
12:06:22 -!- mtm has joined.
12:08:50 <esolangs> [[Combinatory logic]] https://esolangs.org/w/index.php?diff=150835&oldid=146889 * Pro465 * (+12) /* SKI calculus */ add original name of S combinator
12:15:06 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150836&oldid=150832 * PrySigneToFry * (+1847)
12:15:34 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150837&oldid=150836 * PrySigneToFry * (+1)
12:19:25 <esolangs> [[User talk:Tommyaweosme/Emojic collab with yayimhere and ractangle]] https://esolangs.org/w/index.php?diff=150838&oldid=150698 * PrySigneToFry * (+206)
12:26:35 <esolangs> [[Combinatory logic]] https://esolangs.org/w/index.php?diff=150839&oldid=150835 * Pro465 * (+211) /* External resources */ add Moses (1924) paper
12:31:00 -!- FreeFull has quit (Remote host closed the connection).
12:48:26 <esolangs> [[NOR Machine]] M https://esolangs.org/w/index.php?diff=150840&oldid=150834 * Unname4798 * (-3) AND gate is certainly correct.
12:50:32 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150841&oldid=150837 * Unname4798 * (-1) /* Alternated introduction */
12:52:50 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150842&oldid=150841 * Unname4798 * (-52) /* Alternate introduction */
12:56:51 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150843&oldid=150842 * Unname4798 * (+278) /* Type 34 */
12:57:48 -!- Sgeo_ has quit (Read error: Connection reset by peer).
13:03:59 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150844&oldid=150815 * Blashyrkh * (+268) Time complexity
13:08:03 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150845&oldid=150844 * Blashyrkh * (+25)
13:19:34 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150846&oldid=150845 * Blashyrkh * (+11)
13:33:35 <esolangs> [[User:PrySigneToFry/Discussion]] https://esolangs.org/w/index.php?diff=150847&oldid=149474 * PrySigneToFry * (+63)
13:44:33 <esolangs> [[User talk:Tommyaweosmalt]] N https://esolangs.org/w/index.php?oldid=150848 * PrySigneToFry * (+471) /* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */ new section
13:53:10 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150849&oldid=150843 * PkmnQ * (+887) /* Dialects created in 2025 */ [[Recursive]] derivatives
13:58:14 -!- amby has joined.
14:01:51 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150850&oldid=150849 * Unname4798 * (-196) /* Dialects created in 2025 */
14:02:26 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150851&oldid=150850 * Unname4798 * (+196) Undo revision [[Special:Diff/150850|150850]] by [[Special:Contributions/Unname4798|Unname4798]] ([[User talk:Unname4798|talk]])
14:11:08 <esolangs> [[]] M https://esolangs.org/w/index.php?diff=150852&oldid=150851 * PkmnQ * (+17) forgot to add this
14:19:04 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150853&oldid=150852 * PrySigneToFry * (+685)
14:20:50 <esolangs> [[Recursive]] https://esolangs.org/w/index.php?diff=150854&oldid=139785 * PkmnQ * (+241) /* See also */
14:27:36 <esolangs> [[DeleteScript]] https://esolangs.org/w/index.php?diff=150855&oldid=116124 * PrySigneToFry * (+287)
15:19:46 <esolangs> [[TM]] https://esolangs.org/w/index.php?diff=150856&oldid=150821 * I am islptng * (+132)
15:20:51 <esolangs> [[Huit]] M https://esolangs.org/w/index.php?diff=150857&oldid=137676 * TheCanon2 * (+59)
15:26:04 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150858&oldid=150853 * I am islptng * (+447) /* Type 40 */
15:26:34 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150859&oldid=150858 * I am islptng * (+4) /* Turing-complete */
15:34:15 <esolangs> [[Language list]] M https://esolangs.org/w/index.php?diff=150860&oldid=150774 * Buckets * (+9)
15:34:25 <esolangs> [[-1]] N https://esolangs.org/w/index.php?oldid=150861 * Buckets * (+1889) Created page with "-1 is An esoteric programming language, where [[User:Buckets]] found out -1 hasn't been created yet, So [[User:Buckets]] just thought of random idea for this esolang, "What if the code was Tables?" The most awful idea, That took 3 days to Complete just the Commands. The code
15:35:26 <esolangs> [[User:Buckets]] https://esolangs.org/w/index.php?diff=150862&oldid=150305 * Buckets * (+9)
15:36:06 <esolangs> [[-1]] M https://esolangs.org/w/index.php?diff=150863&oldid=150861 * Buckets * (+9)
15:38:03 <esolangs> [[-1]] M https://esolangs.org/w/index.php?diff=150864&oldid=150863 * Buckets * (+38)
15:52:14 <esolangs> [[WhatLang]] https://esolangs.org/w/index.php?diff=150865&oldid=150686 * DGCK81LNN * (+93) /* Example programs */
15:52:56 -!- molson has joined.
15:55:13 -!- molson_ has quit (Ping timeout: 252 seconds).
15:58:42 -!- fungot has quit (Ping timeout: 246 seconds).
16:24:39 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150866&oldid=150793 * Calculus is fun * (+200) /* 99 bottles of beer */
16:25:11 <b_jonas> zzo38: https://github.com/Nakazoto/UEVTC/wiki has some more info about the vacuum tube computer that Usagi Electronics is building, but that info is described as out of date. there's a new video https://www.youtube.com/watch?v=z4KVNAmwND8 which declares the computer build finished
16:32:52 <esolangs> [[Esolang talk:Categorization]] https://esolangs.org/w/index.php?diff=150867&oldid=150795 * Ais523 * (+537) /* Category for esoteric supersets */ why I think that would be a bad idea
16:41:25 <esolangs> [[The last line of this page]] N https://esolangs.org/w/index.php?oldid=150868 * PkmnQ * (+3921) Created page with "{{Wrongtitle|title=<nowiki>[[Category:No-code esolang]] [[Category:Unimplemented]]</nowiki>}} [[The last line of this page|<nowiki>[[Category:No-code esolang]] [[Category:Unimplemented]]</nowiki>]] is a [[:Category:No-code esolang|no-code esolang]]. How
16:44:37 <esolangs> [[UE1]] N https://esolangs.org/w/index.php?oldid=150869 * B jonas * (+451) Created page with "The '''UE1''' or '''UE-1''' is a homebrew retro hardware computer built by Usagi Electric between 2020 and 2025 from vacuum tubes (thermionic valves). == Links == * [https://www.youtube.com/playlist?list=PLnw98JPyObn0v-98gRV9PfzAQONTKxql3 Video series of the construction
16:44:45 <esolangs> [[Talk:-1]] N https://esolangs.org/w/index.php?oldid=150870 * PkmnQ * (+253) Created page with "Kind of surprised this wasn't taken earlier. I noticed and had a plan for this a while ago, but I couldn't find a way to make it work. Nice to finally see an esolang named -1. -~~~~"
16:50:27 <esolangs> [[Joke language list]] https://esolangs.org/w/index.php?diff=150871&oldid=150397 * PkmnQ * (+175) /* General languages */ [[Recursive]] and [[The last line of this page|<nowiki>[[Category:No-code esolang]] [[Category:Unimplemented]]</nowiki>]]
16:52:01 <esolangs> [[User:B jonas/List]] https://esolangs.org/w/index.php?diff=150872&oldid=139041 * B jonas * (+86) UE1
16:52:14 <esolangs> [[User:B jonas]] https://esolangs.org/w/index.php?diff=150873&oldid=150716 * B jonas * (-190) /* Todo */
16:52:45 <b_jonas> I don't think I'm going to learn more about this one so it's best to just create a stub page with a pointer
16:59:04 <esolangs> [[Action symbol]] https://esolangs.org/w/index.php?diff=150874&oldid=144458 * Yayimhere2(school) * (-1) /* how it works */
17:02:42 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150875&oldid=150620 * Dmiz * (+515)
17:03:29 <esolangs> [[DeleteScript]] https://esolangs.org/w/index.php?diff=150876&oldid=150855 * 47 * (-11) /* Another method in Windows */
17:04:25 <esolangs> [[User talk:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=150877&oldid=150848 * 47 * (+77)
17:06:59 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150878&oldid=150746 * Unname4798 * (+846)
17:07:40 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=150879&oldid=150111 * 47 * (+44) /* Implementations */
17:08:44 <esolangs> [[Shape-Machine]] https://esolangs.org/w/index.php?diff=150880&oldid=150879 * 47 * (+0) welcome back old formula
17:09:35 <esolangs> [[User:Unname4798]] M https://esolangs.org/w/index.php?diff=150881&oldid=150878 * Unname4798 * (-1)
17:13:03 <esolangs> [[User talk:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=150882&oldid=150877 * 47 * (-3) /* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */
17:13:24 <esolangs> [[User:B jonas/List]] https://esolangs.org/w/index.php?diff=150883&oldid=150872 * B jonas * (+145) +[[Scrip7]]
17:14:05 <esolangs> [[User talk:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=150884&oldid=150882 * 47 * (+329) /* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */ added Unname's thing
17:15:25 <esolangs> [[User talk:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=150885&oldid=150884 * 47 * (+1) /* I've noticed that you and your original account that uses a lot of emojis and non-compliant sentences (often without periods). */
17:30:37 <esolangs> [[-1]] https://esolangs.org/w/index.php?diff=150886&oldid=150864 * Hakerh400 * (+33) Add the "See also" section
17:32:34 <esolangs> [[Imprecision]] https://esolangs.org/w/index.php?diff=150887&oldid=137737 * Hakerh400 * (+20) Add a similar esolang to the "See also" section
17:36:10 -!- craigo has joined.
17:36:21 -!- craigo has quit (Read error: Connection reset by peer).
17:37:09 -!- craigo has joined.
18:14:15 <esolangs> [[GD auto level]] https://esolangs.org/w/index.php?diff=150888&oldid=138746 * Unname4798 * (+1161) the official version of [[Gd auto level]]
18:15:18 <esolangs> [[GD auto level]] M https://esolangs.org/w/index.php?diff=150889&oldid=150888 * Unname4798 * (+2) (I mean the page, not the model itself)
18:16:43 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150890&oldid=150881 * Unname4798 * (-845) delete an attempt to host user talk pages somewhere else
18:17:35 -!- DOS_User_webchat has joined.
18:18:06 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:20:40 -!- FreeFull has joined.
18:21:13 -!- Lord_of_Life has joined.
18:26:31 -!- DOS_User_webchat has quit (Remote host closed the connection).
19:00:23 <esolangs> [[Fuck 2red]] N https://esolangs.org/w/index.php?oldid=150891 * Tommyaweosme * (+574) Created page with "Fuck 2red is an esolang created by [[user:tommyaweosme]] after he got banned on pixilart == commands == commands are stacks of "fuck 2red" seperated by "Fuck 2red" 1 + 2 - 3 > 4 < 5 . 6 , 7 [ 8 ] == cat == fuck 2red fuck 2red fuck 2red fuck 2red fuck 2red
19:01:37 <esolangs> [[GD auto level]] https://esolangs.org/w/index.php?diff=150892&oldid=150889 * Tommyaweosme * (-1163) literally a copy
19:29:50 <esolangs> [[Talk:Fuck 2red]] N https://esolangs.org/w/index.php?oldid=150893 * 47 * (+69) Created page with "how did you got banned in pixelart of all things~~~"
19:30:18 <esolangs> [[Talk:Fuck 2red]] https://esolangs.org/w/index.php?diff=150894&oldid=150893 * 47 * (+0)
19:35:38 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=150895&oldid=150776 * 47 * (+13) /* Stuff to continue */
19:54:42 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=150896&oldid=150866 * Calculus is fun * (+6) /* Behavior */
19:57:41 <esolangs> [[LJAPL]] https://esolangs.org/w/index.php?diff=150897&oldid=146249 * 47 * (+484)
19:58:06 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=150898&oldid=150895 * 47 * (-11) /* Stuff to continue */
19:58:37 <esolangs> [[MoreMathRPN/Brainfuck interpreter]] M https://esolangs.org/w/index.php?diff=150899&oldid=150408 * Calculus is fun * (+50) Self-Interpreter is command.
19:59:41 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=150900&oldid=150639 * 47 * (+32) /* Esolangs */
20:25:00 -!- ski has quit (Quit: Lost terminal).
20:55:23 <esolangs> [[Talk:Fuck 2red]] https://esolangs.org/w/index.php?diff=150901&oldid=150894 * Tommyaweosme * (+306)
20:58:50 -!- Guest57 has joined.
21:01:53 -!- Guest57 has quit (Client Quit).
21:06:29 -!- Sgeo has joined.
21:35:48 -!- chomwitt has quit (Ping timeout: 245 seconds).
21:44:32 <esolangs> [[LJAPL]] https://esolangs.org/w/index.php?diff=150902&oldid=150897 * Calculus is fun * (+164) Hello world
22:03:05 <esolangs> [[LJAPL]] https://esolangs.org/w/index.php?diff=150903&oldid=150902 * Calculus is fun * (+2742) Added MoreMathRPN esointerpreter
22:05:40 <esolangs> [[LJAPL]] M https://esolangs.org/w/index.php?diff=150904&oldid=150903 * Calculus is fun * (+37) /* Hello world */
22:16:40 <esolangs> [[Shape-Machine]] M https://esolangs.org/w/index.php?diff=150905&oldid=150880 * Calculus is fun * (+15) added pseudocode
22:17:26 <esolangs> [[Shape-Machine]] M https://esolangs.org/w/index.php?diff=150906&oldid=150905 * Calculus is fun * (+1) /* MoreMathRPN */
22:41:42 <b_jonas> yeah, there's very little info there so it won't help
22:41:52 <esolangs> [[Esolang:Help]] https://esolangs.org/w/index.php?diff=150907&oldid=142045 * Calculus is fun * (+350) How to do tables
22:44:58 <esolangs> [[Esolang:Help]] https://esolangs.org/w/index.php?diff=150908&oldid=150907 * Calculus is fun * (+66) /* Text formatting and organization */
22:45:28 <esolangs> [[Esolang:Help]] M https://esolangs.org/w/index.php?diff=150909&oldid=150908 * Calculus is fun * (-8) /* Text formatting and organization */
22:46:38 <esolangs> [[Esolang:Help]] M https://esolangs.org/w/index.php?diff=150910&oldid=150909 * Calculus is fun * (+0) /* Tables */
23:40:42 <esolangs> [[Talk:Segreq]] M https://esolangs.org/w/index.php?diff=150911&oldid=77658 * Calculus is fun * (+114) expression name question
23:41:04 <esolangs> [[Talk:Segreq]] M https://esolangs.org/w/index.php?diff=150912&oldid=150911 * Calculus is fun * (+107) /* Naming */
00:02:46 -!- mtm has quit (Ping timeout: 252 seconds).
00:04:06 -!- molson_ has joined.
00:06:02 -!- mtm has joined.
00:08:06 -!- molson has quit (Ping timeout: 272 seconds).
00:33:11 -!- DOS_User_webchat has joined.
00:34:51 -!- DOS_User_webchat has quit (Remote host closed the connection).
00:51:38 <esolangs> [[Esolang:Categorization]] M https://esolangs.org/w/index.php?diff=150913&oldid=150796 * Somefan * (+29)
01:17:33 -!- somefan has joined.
01:32:14 -!- somefan has quit (Quit: Client closed).
01:46:58 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:10:41 <esolangs> [[User:Tommyaweosme]] https://esolangs.org/w/index.php?diff=150914&oldid=150608 * PrySigneToFry * (+91)
02:12:06 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150915&oldid=150890 * PrySigneToFry * (-2)
02:14:53 <esolangs> [[DeleteScript]] https://esolangs.org/w/index.php?diff=150916&oldid=150876 * PrySigneToFry * (+39)
02:40:17 <esolangs> [[User:Tommyaweosme]] M https://esolangs.org/w/index.php?diff=150917&oldid=150914 * Tommyaweosme * (-107) restore
03:07:56 -!- craigo has quit (Ping timeout: 252 seconds).
03:18:49 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150918&oldid=148352 * PrySigneToFry * (+3) Fixed command for the cat program.
07:02:18 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150919&oldid=150915 * Ractangle * (+2) oh no you don't
07:19:59 -!- Sgeo has quit (Read error: Connection reset by peer).
07:44:30 -!- lisbeths has joined.
08:14:42 -!- xelxebar_ has quit (Quit: ZNC 1.7.2+deb3 - https://znc.in).
08:15:54 -!- xelxebar has joined.
08:19:23 <esolangs> [[Special:Log/newusers]] create * NMNS * New user account
08:57:18 <esolangs> [[User:Blashyrkh/Kolakoski-brainfuck]] M https://esolangs.org/w/index.php?diff=150920&oldid=150846 * Blashyrkh * (-10) minor comment fix
09:29:15 <esolangs> [[Talk:BOREDOM]] https://esolangs.org/w/index.php?diff=150921&oldid=148246 * PrySigneToFry * (+882) /* It just like... */ new section
09:44:29 <esolangs> [[Talk:BOREDOM]] https://esolangs.org/w/index.php?diff=150922&oldid=150921 * PrySigneToFry * (+125)
09:46:40 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150923&oldid=150919 * PrySigneToFry * (-2) I had to, because this user had almost no impression of me.
09:48:31 <esolangs> [[User:Tommyaweosme]] https://esolangs.org/w/index.php?diff=150924&oldid=150917 * PrySigneToFry * (+198)
09:53:16 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150925&oldid=150859 * PrySigneToFry * (+73)
09:56:23 <esolangs> [[UserEdited]] https://esolangs.org/w/index.php?diff=150926&oldid=149353 * PrySigneToFry * (+296)
10:03:25 -!- lisbeths has quit (Quit: Connection closed for inactivity).
10:07:56 -!- ais523 has joined.
10:10:05 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150927&oldid=150925 * PrySigneToFry * (+2226)
10:11:27 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=150928&oldid=150691 * PrySigneToFry * (+892) /* */ new section
12:02:34 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:40 -!- mtm has joined.
12:12:40 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150929&oldid=150923 * Unname4798 * (-35) deleting PrySigneToFry from the warsides
12:14:26 <esolangs> [[]] N https://esolangs.org/w/index.php?oldid=150930 * PrySigneToFry * (+2398) Created page with "{{WIP}} is an Esolang designed by PSTF. It is Chinese version of [[]](?). The author also inspired from the wasted Esolang GaoErFu by islptng and [[Sclipting]] by Timwi. = Language Overview = Everything is like except: <pre> ... -- ... -- -- ... -- ... --
12:15:06 <esolangs> [[Language list]] https://esolangs.org/w/index.php?diff=150931&oldid=150860 * PrySigneToFry * (+10)
12:20:10 <esolangs> [[Trigger]] https://esolangs.org/w/index.php?diff=150932&oldid=20055 * Unname4798 * (-160)
12:20:18 <esolangs> [[Trigger]] https://esolangs.org/w/index.php?diff=150933&oldid=150932 * Unname4798 * (+160) Undo revision [[Special:Diff/150932|150932]] by [[Special:Contributions/Unname4798|Unname4798]] ([[User talk:Unname4798|talk]])
12:33:17 <esolangs> [[GD auto level]] https://esolangs.org/w/index.php?diff=150934&oldid=150892 * Unname4798 * (+1163) Undo revision [[Special:Diff/150892|150892]] by [[Special:Contributions/Tommyaweosme|Tommyaweosme]] ([[User talk:Tommyaweosme|talk]]) (not entirely a copy)
12:44:06 <esolangs> [[UserEdited]] M https://esolangs.org/w/index.php?diff=150935&oldid=150926 * Unname4798 * (+3)
13:14:07 -!- amby has joined.
13:41:08 <esolangs> [[User:Tommyaweosme]] https://esolangs.org/w/index.php?diff=150936&oldid=150924 * Ais523 * (-198) Undo revision [[Special:Diff/150924|150924]] by [[Special:Contributions/PrySigneToFry|PrySigneToFry]] ([[User talk:PrySigneToFry|talk]]) too large an edit to be appropriate to be making to a different user's userpage
14:02:02 -!- chomwitt has joined.
14:16:04 -!- Lord_of_Life has quit (Excess Flood).
14:17:28 -!- Lord_of_Life has joined.
14:29:35 -!- ski has joined.
14:31:41 <esolangs> [[Esolang:Sandbox]] https://esolangs.org/w/index.php?diff=150937&oldid=149134 * PrySigneToFry * (-2)
14:35:44 <esolangs> [[Esolang:Sandbox]] https://esolangs.org/w/index.php?diff=150938&oldid=150937 * PrySigneToFry * (+3769) Will Esolang Wiki display the historical glyphs(such as Cuneiforms) well?
14:36:13 <esolangs> [[Esolang:Sandbox]] https://esolangs.org/w/index.php?diff=150939&oldid=150938 * PrySigneToFry * (-3769) OK it can, so I had to clean up the sandbox!
14:50:51 -!- craigo has joined.
14:53:33 -!- craigo has quit (Client Quit).
14:54:25 -!- craigo has joined.
15:41:59 <esolangs> [[Smasnug]] https://esolangs.org/w/index.php?diff=150940&oldid=150622 * Win7HE * (+65) /* the new smaooong commands */
15:42:58 <esolangs> [[Smasnug]] https://esolangs.org/w/index.php?diff=150941&oldid=150940 * Win7HE * (+60)
15:45:01 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=150942&oldid=150929 * Unname4798 * (+30)
16:43:32 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150943&oldid=150833 * YufangTSTSU * (+96) /* Any interests on joining our Esolang Tencent QQ group? */ new section
16:43:48 <esolangs> [[User talk:PrySigneToFry]] M https://esolangs.org/w/index.php?diff=150944&oldid=150943 * YufangTSTSU * (+97)
18:19:36 -!- Lord_of_Life_ has joined.
18:20:27 -!- Lord_of_Life has quit (Ping timeout: 276 seconds).
18:20:59 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
19:16:10 -!- ais523 has quit (Quit: quit).
19:45:25 <esolangs> [[Useful brainfuck]] https://esolangs.org/w/index.php?diff=150945&oldid=125622 * Kaveh Yousefi * (+619) Introduced two further example programs, added a hyperlink to my implementation on GitHub, and supplemented the page category tag Implemented.
20:36:57 <esolangs> [[Talk:GD auto level]] N https://esolangs.org/w/index.php?oldid=150946 * Tommyaweosme * (+566) Created page with "this is a carbon copy, attributed to me and the only change is the capitalization. no this is not the official one, and this page never should have been created in the first place. and remember, you attributed it to me so i can delete my attributed work o
21:03:06 -!- chomwitt has quit (Ping timeout: 246 seconds).
21:21:20 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150947&oldid=150875 * Dmiz * (+6)
22:10:58 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150948&oldid=150947 * Dmiz * (+2620)
22:27:19 -!- molson_ has quit (Ping timeout: 260 seconds).
22:28:15 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150949&oldid=150948 * Dmiz * (+17)
23:20:58 -!- chomwitt has joined.
23:27:27 -!- chomwitt has quit (Ping timeout: 252 seconds).
23:48:00 <esolangs> [[Password generator]] N https://esolangs.org/w/index.php?oldid=150950 * Dmiz * (+284) Created page with "The Password generator is a Program created by ~~~ <br> this program test this program tests: *randomness *input *output *loop the program prompts for input: <br> print a random letter from a to z <br> repeat the last command of the input"
23:48:42 <esolangs> [[Password generator]] https://esolangs.org/w/index.php?diff=150951&oldid=150950 * Dmiz * (+27)
00:04:07 -!- mtm has quit (Ping timeout: 252 seconds).
00:06:10 -!- mtm has joined.
00:08:50 -!- Sgeo has joined.
00:36:22 <esolangs> [[Talk:GD auto level]] https://esolangs.org/w/index.php?diff=150952&oldid=150946 * Ais523 * (+338) derivative pages should be about the derivative, rather than necessarily copying everything from the original language page
01:49:14 <esolangs> [[User:Tommyaweosme/albuquerque hexdump]] N https://esolangs.org/w/index.php?oldid=150953 * Tommyaweosme * (+18622) Created page with "<pre>576179206261636b207768656e204920776173206a7573742061206c6974746c6520626974747920626f79 4c6976696e6720696e206120626f7820756e6465722074686520737461697273 496e2074686520636f726e6572206f662074686520626173656d656e74206f662074686520686
01:50:48 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150954&oldid=150944 * PrySigneToFry * (+990)
02:05:29 -!- Melvar has quit (Ping timeout: 252 seconds).
02:05:54 <esolangs> [[User talk:I am islptng/Sandbox]] https://esolangs.org/w/index.php?diff=150955&oldid=149612 * PrySigneToFry * (+0) p
02:17:30 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150956&oldid=150949 * Dmiz * (+10)
02:18:51 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
02:24:05 -!- Melvar has joined.
04:25:42 <esolangs> [[IBSA]] https://esolangs.org/w/index.php?diff=150957&oldid=122744 * Simple9371 * (+120) /* Flow definition */ Added clarifications
04:27:23 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150958&oldid=150957 * Simple9371 * (+6) /* Flow definition */
04:28:51 <esolangs> [[User talk:I am islptng/Sandbox]] https://esolangs.org/w/index.php?diff=150959&oldid=150955 * I am islptng * (+0) is used for "False" so I have to use .
04:37:28 -!- rodgort has quit (Ping timeout: 245 seconds).
04:41:14 -!- craigo has quit (Quit: Leaving).
04:51:43 -!- rodgort has joined.
05:24:10 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150960&oldid=150958 * Simple9371 * (+2) /* Flow definition */
05:43:05 <esolangs> [[User:I am islptng/SingleOperandAssembly]] N https://esolangs.org/w/index.php?oldid=150961 * I am islptng * (+806) Created page with "== Instructions == The RISC has 16 instructions, each of them has exactly 1 operand. The computer has a register to store the result of calculations. {|class=wikitable ! Hex !! Keyword !! Meaning |- | 0 || imd x || reg = x |- | 1 ||
05:44:08 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150962&oldid=150960 * Simple9371 * (-60) /* Flow definition */
05:57:41 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150963&oldid=150962 * Simple9371 * (-25) /* Flow definition */
06:06:34 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150964&oldid=150963 * Simple9371 * (-5) /* Flow definition */
06:18:21 <esolangs> [[X bottles of beers, take y down, x and y are in Real Numbers Set]] https://esolangs.org/w/index.php?diff=150965&oldid=134366 * PrySigneToFry * (+123)
06:24:29 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150966&oldid=150930 * PrySigneToFry * (+255)
06:24:49 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150967&oldid=150966 * PrySigneToFry * (+1)
06:26:07 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150968&oldid=150967 * PrySigneToFry * (+186)
06:41:28 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150969&oldid=150964 * Simple9371 * (+1) /* Computational class */ converted > translated
06:50:56 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150970&oldid=150969 * Simple9371 * (-4) /* Flow definition */ Remove 'now'
06:52:54 <esolangs> [[IBSA]] M https://esolangs.org/w/index.php?diff=150971&oldid=150970 * Simple9371 * (-4) /* Flow definition */ Oops
07:28:28 <esolangs> [[Truth-machine]] https://esolangs.org/w/index.php?diff=150972&oldid=149845 * WinslowJosiah * (+84) Add Truth-machine in Bespoke
08:08:20 -!- Sgeo has quit (Read error: Connection reset by peer).
08:45:08 <esolangs> [[User:PrySigneToFry]] https://esolangs.org/w/index.php?diff=150973&oldid=148968 * PrySigneToFry * (+319)
11:13:53 <esolangs> [[Zyxonia/Libraries]] N https://esolangs.org/w/index.php?oldid=150974 * PrySigneToFry * (+1194) Created page with "{{Back|Zyxonia}} Zyxonia has lots of libraries. They often used to make more functions, and do special things in Zyxonia. Here are some useful libraries. == MATH == This library provides mathematical calculations. <pre> SIN a COS a TAN a COT a SEC a C
11:15:17 <esolangs> [[Zyxonia]] https://esolangs.org/w/index.php?diff=150975&oldid=150813 * PrySigneToFry * (+57)
12:02:59 -!- mtm has quit (Ping timeout: 260 seconds).
12:05:45 -!- mtm has joined.
14:48:08 <esolangs> [[User:I am islptng/Sandbox]] https://esolangs.org/w/index.php?diff=150976&oldid=149867 * I am islptng * (+7539) 99% by Deepseek AI!
15:42:58 -!- amby has joined.
18:19:57 -!- Lord_of_Life_ has joined.
18:21:00 -!- Lord_of_Life has quit (Ping timeout: 260 seconds).
18:22:44 -!- Lord_of_Life_ has quit (Excess Flood).
18:27:47 -!- Lord_of_Life has joined.
18:41:35 <esolangs> [[Demlang]] N https://esolangs.org/w/index.php?oldid=150977 * Cocosbeans * (+2628) Created page with "[[Category:2025]] [[Category:Joke_languages]] [[Category:Languages]] [[Category:Unimplemented]] '''Demlang''' is an object-oriented joke language created by [[User:Cocosbeans]] in 2025. The concept of the language is that any data created in a file, including variabl
19:01:04 -!- korvo has quit (Ping timeout: 260 seconds).
19:01:04 -!- pikhq has quit (Ping timeout: 260 seconds).
19:01:39 -!- dnm has quit (Ping timeout: 260 seconds).
19:01:39 -!- voxpelli has quit (Ping timeout: 260 seconds).
19:02:14 -!- Lymia has quit (Ping timeout: 260 seconds).
19:02:15 -!- integral has quit (Ping timeout: 260 seconds).
19:02:36 -!- Lymia has joined.
19:03:34 -!- dnm has joined.
19:03:37 -!- voxpelli has joined.
19:03:40 -!- integral has joined.
19:03:51 -!- pikhq has joined.
19:48:09 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150978&oldid=150956 * Dmiz * (+69)
20:51:42 <esolangs> [[User:Jan jelo/My fourth BF quine]] N https://esolangs.org/w/index.php?oldid=150979 * Jan jelo * (+3859) Created page with "The following is a [[Quine]] by [[User:Jan jelo]] in [[Brainfuck]],requires negative indexes: <pre class="rectwrap"> >++++>++>+>++>+>+>++++>++++>+>++>+++>+>++++>++>+>++++>++>+>+>+>+>++>+>+>++>+>+>+>+>+++>++>+>+>+>+>+++>++>+++>+>++>+++>+>++>++
21:22:10 -!- craigo has joined.
22:11:18 -!- Lord_of_Life has quit (Quit: Laa shay'a waqi'un moutlaq bale kouloun moumkine).
22:11:40 -!- Lord_of_Life has joined.
22:12:41 -!- DOS_User_webchat has joined.
22:30:31 -!- DOS_User_webchat has quit (Remote host closed the connection).
23:01:06 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150980&oldid=150978 * Dmiz * (+29)
23:02:55 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150981&oldid=150980 * Dmiz * (+4)
23:13:37 -!- Sgeo has joined.
00:04:05 -!- mtm has quit (Ping timeout: 248 seconds).
00:06:23 -!- mtm has joined.
01:18:59 -!- korvo has joined.
02:12:35 -!- amby has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
03:25:39 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150982&oldid=150968 * PrySigneToFry * (+16)
03:47:47 -!- SGautam has joined.
04:00:30 -!- molson has joined.
04:17:00 <esolangs> [[User:Jan jelo/My fourth BF quine]] M https://esolangs.org/w/index.php?diff=150983&oldid=150979 * Jan jelo * (+2)
04:17:38 <esolangs> [[User:Jan jelo]] https://esolangs.org/w/index.php?diff=150984&oldid=150614 * Jan jelo * (+38) /* Other */
04:23:55 <esolangs> [[User:I am islptng/Sandbox]] https://esolangs.org/w/index.php?diff=150985&oldid=150976 * I am islptng * (-6412) Manual translation and edit.
04:59:12 -!- m5zs7k has quit (Ping timeout: 272 seconds).
05:06:48 -!- m5zs7k has joined.
05:55:04 -!- lisbeths has joined.
06:27:02 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150986&oldid=150982 * PrySigneToFry * (+455)
06:27:11 -!- SGautam has quit (Quit: Connection closed for inactivity).
07:15:58 <esolangs> [[ReverseFuck]] https://esolangs.org/w/index.php?diff=150987&oldid=139265 * PrySigneToFry * (+15) Make more people can understand
07:18:58 <esolangs> [[VERPNL]] https://esolangs.org/w/index.php?diff=150988&oldid=148767 * PrySigneToFry * (+54)
07:25:12 <esolangs> [[User talk:/w/wiki/index.php/Talk:index.php/Main page]] https://esolangs.org/w/index.php?diff=150989&oldid=150053 * PrySigneToFry * (+541)
07:29:12 <esolangs> [[User talk:Unname4798]] https://esolangs.org/w/index.php?diff=150990&oldid=148905 * PrySigneToFry * (+1845)
08:07:59 -!- Sgeo has quit (Read error: Connection reset by peer).
08:21:59 -!- craigo has quit (Ping timeout: 260 seconds).
08:24:55 <esolangs> [[Special:Log/newusers]] create * 1llCodeAnything * New user account
09:14:24 -!- lisbeths has quit (Quit: Connection closed for inactivity).
12:03:43 -!- mtm has quit (Ping timeout: 245 seconds).
12:05:28 -!- mtm has joined.
12:13:44 -!- chomwitt has joined.
12:20:01 <esolangs> [[Special:Log/delete]] delete * Ais523 * deleted "[[User:Tommyaweosme/albuquerque hexdump]]": Copyright violation: not public domain (hexdumping a file doesn't uncopyright it, it's still a derivative of a copyrighted work and thus copyrighted)
13:02:18 <esolangs> [[Mazerunner]] https://esolangs.org/w/index.php?diff=150991&oldid=150523 * BrainFuckGirl * (+3) /* Disan Count */ corrected error in code example
13:35:49 <esolangs> [[]] https://esolangs.org/w/index.php?diff=150992&oldid=150986 * PrySigneToFry * (+258)
15:41:29 -!- chomwitt has quit (Ping timeout: 265 seconds).
16:06:47 <esolangs> [[^ RGB8 panel]] https://esolangs.org/w/index.php?diff=150993&oldid=150751 * Unname4798 * (-86)
17:12:33 <esolangs> [[User:Blashyrkh/A+B-brainfuck]] N https://esolangs.org/w/index.php?oldid=150994 * Blashyrkh * (+8513) A+B in Brainfuck, 322 bytes long
17:12:47 -!- amby has joined.
17:16:51 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=150995&oldid=150981 * Dmiz * (+197)
17:26:58 <esolangs> [[A+B Problem/brainfuck]] https://esolangs.org/w/index.php?diff=150996&oldid=126008 * Blashyrkh * (+770) One more A+B implementation in Brainfuck. Arbitrary non-negative integers, low memory consumption
17:34:34 <esolangs> [[User:Blashyrkh]] N https://esolangs.org/w/index.php?oldid=150997 * Blashyrkh * (+408) Links to subpages on the personal page
17:35:56 <esolangs> [[User:Blashyrkh]] M https://esolangs.org/w/index.php?diff=150998&oldid=150997 * Blashyrkh * (+0) fix link
17:49:03 <esolangs> [[User:QuantumV]] N https://esolangs.org/w/index.php?oldid=150999 * QuantumV * (+15) Created page with "I make esolangs"
18:11:57 -!- craigo has joined.
18:15:27 -!- chomwitt has joined.
18:18:39 -!- Lord_of_Life has quit (Read error: Connection reset by peer).
18:22:05 -!- Lord_of_Life has joined.
19:50:59 -!- craigo_ has joined.
19:51:13 -!- craigo has quit (Remote host closed the connection).
20:35:57 -!- chomwitt has quit (Ping timeout: 246 seconds).
21:14:33 -!- DOS_User_webchat has joined.
21:43:23 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=151000&oldid=150995 * Dmiz * (+224) Undo revision [[Special:Diff/150620|150620]] by [[Special:Contributions/Dmiz|Dmiz]] ([[User talk:Dmiz|talk]])
21:43:40 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=151001&oldid=151000 * Dmiz * (+1)
21:44:40 -!- DOS_User_webchat has quit (Ping timeout: 240 seconds).
21:45:51 -!- DOS_User_webchat has joined.
21:46:49 -!- ajal has joined.
21:47:27 -!- amby has quit (Ping timeout: 252 seconds).
22:14:49 -!- DOS_User_webchat has quit (Remote host closed the connection).
23:01:46 <esolangs> [[Gd auto level]] https://esolangs.org/w/index.php?diff=151002&oldid=138745 * Tommyaweosme * (+24)
00:09:07 -!- Sgeo has joined.
00:46:12 <esolangs> [[PIKOlang]] M https://esolangs.org/w/index.php?diff=151003&oldid=134150 * Matronator * (+31)
00:53:24 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=151004&oldid=150802 * AdjectiveNounNumber * (+435)
01:02:49 <esolangs> [[LJAPL]] M https://esolangs.org/w/index.php?diff=151005&oldid=150904 * Calculus is fun * (-1087) Changed link with compressed version
01:07:31 <esolangs> [[Convert]] https://esolangs.org/w/index.php?diff=151006&oldid=151004 * AdjectiveNounNumber * (-16)
01:43:16 -!- ajal has quit (Quit: so long suckers! i rev up my motorcylce and create a huge cloud of smoke. when the cloud dissipates im lying completely dead on the pavement).
01:44:07 <esolangs> [[PIKOlang]] https://esolangs.org/w/index.php?diff=151007&oldid=151003 * Matronator * (+494) add note about punctuation and usage in other languages
02:34:21 <korvo> Did folks see this yet? https://github.com/ccz181078/Coq-BB5 BB(5,2) and BB(2,4) champions proven to be optimal.
02:35:45 <korvo> ...Did we already talk about this? I don't remember it, but my notes are already updated for it.
02:59:51 -!- ais523 has joined.
03:01:30 <ais523> korvo: we've extensively discussed an announcement that prominently linked to that
03:01:53 <ais523> so a lot of people here have probably discovered it like that, even if we didn't discuss it directly – I know that's how I came across it
03:23:23 <esolangs> [[Lack]] https://esolangs.org/w/index.php?diff=151008&oldid=151001 * Dmiz * (+288)
04:05:18 <korvo> ais523: It's entirely possible that we had an entire multi-hour discussion and I've just forgotten it. Happens a lot.
04:22:16 <esolangs> [[Gd auto level]] https://esolangs.org/w/index.php?diff=151009&oldid=151002 * PrySigneToFry * (+286) Used more formal grammar.
05:11:41 -!- Lykaina has joined.
05:12:53 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151010&oldid=150800 * PrySigneToFry * (+1027) /* I simply use the page without the User: prefix for redirect to my userpage. */ new section
05:14:36 <esolangs> [[PrySigneToFry]] https://esolangs.org/w/index.php?diff=151011&oldid=142737 * PrySigneToFry * (+116) Redirected page to [[User:PrySigneToFry]]
05:15:30 <Lykaina> wrote my first befunge program
05:16:27 <Lykaina> https://lykaina.sdf.org/esolangs/catline.bef
05:17:20 <korvo> Nice! Very neat symmetry. I don't remember how Befunge works; what does it do?
05:18:14 <Lykaina> basically, 2d enhanced brainfuck
05:19:31 <Lykaina> a cat program that stops at newline
05:24:17 <Lykaina> i also wrote an interpreter in python
05:26:47 <Lykaina> the 4 i/o commands need work atm
05:33:26 <esolangs> [[Special:Log/delete]] delete * Ais523 * deleted "[[PrySigneToFry]]": cross-namespace redirect
05:35:10 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151012&oldid=151010 * Ais523 * (+734) /* I simply use the page without the User: prefix for redirect to my userpage. */ that's a cross-namespace redirect, which is not allowed; links to the earlier discussions about it
05:36:16 <ais523> Lykaina: that looks like Befunge-93, right?
05:37:25 <ais523> are you interested in ways to make it smaller/shorter, or do you prefer the way it is? (Most of my use of Befunge has been in golf competitions, so I am used to trying to write it tersely, but of course there's no actual reason to do that)
06:17:05 <myname> befunge golfing can be very fun
06:17:20 <myname> i used to golf a couple of easy project euler tasks
06:23:32 <myname> you could probably do some trampoline stuff with the 5s, like #+5-#+5-# and going left and right over it
06:24:47 <myname> but it's probably easier to just duplicate and drop instead
06:25:16 -!- chomwitt has joined.
07:06:14 -!- mtm has quit (Read error: Connection reset by peer).
07:09:37 -!- mtm has joined.
07:24:12 <esolangs> [[Gd auto level]] https://esolangs.org/w/index.php?diff=151013&oldid=151009 * 47 * (+4)
07:33:56 <esolangs> [[Special:Log/delete]] delete * Ais523 * deleted "[[GD auto level]]": doesn't appear to be a different language from the one at [[Gd auto level]]; makng a second page documenting the same language a PoV fork (thus not allowed), you should come to a consensus on how to document it on the original page
07:52:09 -!- craigo__ has joined.
07:54:39 -!- craigo_ has quit (Ping timeout: 252 seconds).
08:03:03 <esolangs> [[A+B Problem/brainfuck]] M https://esolangs.org/w/index.php?diff=151014&oldid=150996 * Blashyrkh * (+1) If I understand it correctly, this minor change will remove extra examples (mine as well) from the main A+B page
08:04:24 <esolangs> [[A+B Problem/brainfuck]] M https://esolangs.org/w/index.php?diff=151015&oldid=151014 * Blashyrkh * (-1) Remove extra empty line
08:12:02 -!- Sgeo has quit (Read error: Connection reset by peer).
08:22:13 -!- FreeFull has quit (Ping timeout: 252 seconds).
08:24:07 -!- FreeFull has joined.
08:26:32 <esolangs> [[A+B Problem/brainfuck]] M https://esolangs.org/w/index.php?diff=151016&oldid=151015 * Blashyrkh * (+0)
08:30:37 <esolangs> [[User:I am islptng/List of the users that is also in conwaylife.com]] https://esolangs.org/w/index.php?diff=151017&oldid=149619 * I am islptng * (+11) I need contributions to this page!
09:13:21 <esolangs> [[User:I am islptng/List of the users that is also in conwaylife.com]] https://esolangs.org/w/index.php?diff=151018&oldid=151017 * I am islptng * (+53)
09:42:36 <esolangs> [[Special:Log/newusers]] create * X-540 * New user account
09:42:57 <esolangs> [[Gd auto level]] https://esolangs.org/w/index.php?diff=151019&oldid=151013 * PrySigneToFry * (+14)
09:46:48 <esolangs> [[User:I am islptng/List of the users that is also in conwaylife.com]] https://esolangs.org/w/index.php?diff=151020&oldid=151018 * PrySigneToFry * (+22)
09:50:23 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151021&oldid=151012 * PrySigneToFry * (+1129) /* I seem to find that I've written a lot of more formal programming languages. */ new section
09:54:37 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151022&oldid=151021 * Ais523 * (+562) /* I seem to find that I've written a lot of more formal programming languages. */ this wiki is only for esolangs, but most programming languages that can be created quickly by a single person are esolangs
10:08:34 <esolangs> [[Esolang:Introduce yourself]] https://esolangs.org/w/index.php?diff=151023&oldid=150817 * X-540 * (+279) /* Introductions */
10:11:03 <b_jonas> ``` hg cat -r12510 /hackenv/wisdom/password # korvo: we talked about BB(5,2) proven. I hadn't known about BB(2,4) but I'm not paying attention to the busy beaver competitions as much as some other users here.
10:11:07 <HackEso> The password of the month is BB(5) = 47176870
10:12:42 <b_jonas> ``` hg log -r12510 -T '{date(date,"%Y-%m-%d %H:%M")}' /hackenv/wisdom/password # must have been known by that time
10:14:12 <Lykaina> ais523: yeah, it's befunge-93
10:18:44 <Lykaina> i'm writing a befunge-93 interpreter for micropython
10:19:02 <ais523> hmm, I wonder whether the playfield is large enough for that
10:19:10 <ais523> if it isn't, you could switch to befunge-98 which has more space
10:19:33 -!- craigo__ has quit (Quit: Leaving).
10:22:13 <Lykaina> the language the befunge-93 interpreter is written in is micropython
10:22:39 <ais523> oh, that makes more sense
10:23:23 <ais523> this is the sort of channel where if someone said they were writing a C compiler in BF, I would probably a) expect them to fail but b) expect they were genuinely trying
10:24:18 <Lykaina> and, it's a variant of befunge-93 due to ram and lcd limitations
10:25:35 <Lykaina> but the code is being written so it can easily run on 80x25 as well
10:27:53 <Lykaina> the rp2040 only has so much ram
10:29:04 <Lykaina> and the display i'm using is a 240x320 model
10:29:56 <Lykaina> and i want the grid to appear on the lcd while it is running
10:32:55 <Lykaina> the ultimate goal is being able to code the befunge-93 variant on the rp2040 using IR input (17-button remote)
10:38:50 <esolangs> [[User talk:None1]] https://esolangs.org/w/index.php?diff=151024&oldid=149887 * PrySigneToFry * (+983) /* */ new section
10:43:56 <Lykaina> i bought a pico 2w (rp2350 chip) which has twice the ram as the pico w (rp2040 chip) yesterday but it will not arrive until saturday.
10:49:17 <Lykaina> i have no idea why the rp2040 has 294kb ram, when it's direct competitor, the esp32, has 500kb-ish...seems a little shortsighted
10:52:01 <Lykaina> glad they doubled the ram and flash for the rp2350-based Pico 2/Pico 2w (flash on rp2040-based Pico/Pico W is 2MiB)
10:53:26 <Lykaina> flash on a commonly-available esp32 model is 4 MiB
10:58:37 <Lykaina> the rp2350 designers were clearly aware of the esp32s3's capabilities when they designed their chip
11:02:20 <esolangs> [[Seed]] https://esolangs.org/w/index.php?diff=151025&oldid=120207 * None1 * (+27) /* References */
11:06:08 <esolangs> [[SeedFuck]] N https://esolangs.org/w/index.php?oldid=151026 * None1 * (+760) Created page with "'''SeedFuck''' is an esolang invented by [[User:None1]], it is [[seed]] but for [[brainfuck]]. Programs are like this: <length> <seed> ==Random Generator== SeedFuck uses Python 3.11's random generator, it generates numbers from 0-8 and translates the numbers into brainf
11:07:04 <esolangs> [[Joke language list]] https://esolangs.org/w/index.php?diff=151027&oldid=150871 * None1 * (+52) /* Brainfuck derivatives */
11:07:24 <esolangs> [[User:None1]] https://esolangs.org/w/index.php?diff=151028&oldid=150282 * None1 * (+53) /* My Esolangs */
11:09:21 <esolangs> [[]] https://esolangs.org/w/index.php?diff=151029&oldid=150538 * None1 * (+99) /* Commands */
11:26:30 -!- mcfrdy has quit (Quit: quit).
12:03:25 <b_jonas> Lykaina: are you writing the editor itself in befunge? befunge has the p command so it can edit its own playfield so that might work
12:04:48 -!- mtm has quit (Ping timeout: 265 seconds).
12:05:41 -!- mtm has joined.
12:11:22 <esolangs> [[User:Unname4798]] https://esolangs.org/w/index.php?diff=151030&oldid=150942 * Unname4798 * (+680)
12:20:44 <fizzie> I think a lot of RP2040 boards bump up the flash size from the "default" (Pico) 2MB.
12:22:10 <fizzie> (For example I built -- well, half-finished -- a thing on top of the Adafruit Feather RP2040 and it's got 8MB of flash.)
12:24:51 <Lykaina> just woke from nightmare-scene of being in a hotel where it was dark and turning on lights to find i triggered the fire suppression system.
12:27:52 <fizzie> The display for that device is one of those 20x4 character text-only LCDs (though there's enough on-board RAM to have 8 custom symbols).
12:28:01 <fizzie> Didn't think of putting Befunge on it though.
12:40:49 <b_jonas> fizzie: is that for a programmable calculator?
12:46:13 <fizzie> It's for a (pretty pointless) USB peripheral that's a combined temperature/humidity sensor plus a box with a clickable rotary knob + that display, that I can put a menu on and use it to display... stuff. Current plans call it to display, well, the temperature and humidity, but also any alerts from Prometheus monitoring, because I've proven quite adept at ignoring the email alerts.
12:46:47 <fizzie> The thinking is, if I make it so the display backlight is on whenever there's unacknowledged alerts, I'll be more diligent in responding to them.
12:50:46 <fizzie> Which may or may not be true. It's currently stalled on getting the box that houses it made. I did the CAD part of it, and there's a laser cutter here at the office, but I'd need to do two separate visits (first to do a test cut with an array of different tolerances, to see what gives a nice fit; and then to do the real thing) and that feels like so much effort.
12:51:27 <fizzie> Plus I haven't decided exactly what to make it out of, there's a bunch of clear 3mm acrylic here but I'm not sure if I want it to be transparent or not.
12:56:27 <fizzie> Bah, just checked the timestamps, it was like 2023 when I left this, it's been over a year already, that's terrible.
13:14:58 <APic> What! Me worry? ‑ Alfred E. Neumann
13:35:01 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=151031&oldid=149683 * PrySigneToFry * (+592)
13:35:34 -!- chomwitt has quit (Ping timeout: 272 seconds).
13:42:00 <esolangs> [[Talk:SeedFuck]] N https://esolangs.org/w/index.php?oldid=151032 * Blashyrkh * (+362) Created page with "Few suggestions: * "it generates numbers from 0-8" sounds ambiguously, it's better to say "from 0 to 7 inclusive"; * it's not an interpreter, it's a transpiler from SeedFuck to brainfuck; * <pre>k,l=map(int,input().split())</pre> saves one line of python code. Be
14:00:13 <Lykaina> b_jonas: the editor is one i made in micropython
14:02:02 <esolangs> [[Talk:Deadman]] https://esolangs.org/w/index.php?diff=151033&oldid=149285 * Win7HE * (+64)
14:08:57 <esolangs> [[Deadman]] https://esolangs.org/w/index.php?diff=151034&oldid=149294 * Win7HE * (+6) /* (without looping or jumps) Truth Machine */
14:17:10 <esolangs> [[Talk:SeedFuck]] https://esolangs.org/w/index.php?diff=151035&oldid=151032 * Blashyrkh * (+349) and one more suggestion
15:02:28 -!- chomwitt has joined.
15:09:51 <esolangs> [[Gd auto level]] https://esolangs.org/w/index.php?diff=151036&oldid=151019 * PrySigneToFry * (+22) Fixed command for make "Hello, world!" possible to construct
16:17:55 <esolangs> [[Stackfish]] N https://esolangs.org/w/index.php?oldid=151037 * I am islptng * (+175) Created page with " i increment TOS d decrement TOS s square TOS o output TOS z push 0 r push a number read from stdin n put TOS to the bottom of stack p...q Same as bf [] but TOS instead"
16:21:58 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151038&oldid=151037 * I am islptng * (+98)
16:25:17 -!- DOS_User_webchat has joined.
16:30:28 <Lykaina> i have all but one command in my micropython implementation of befunge-93 implemented.
16:31:00 <Lykaina> the command i am having trouble with is '&'
16:31:36 <b_jonas> esolangs, what does the & command do in befunge?
16:31:45 <esolangs> b_jonas: In Befunge, the `&` command is used for **"addressing"**. It takes the current stack pointer and **references the value at that address**. This allows you to manipulate data stored in memory locations. Think of it like a pointer that points to a specific memory location.
16:35:28 <Lykaina> numeric input is what i'm saving for last
16:42:20 -!- DOS_User_webchat has quit (Remote host closed the connection).
16:42:39 -!- DOS_User_webchat has joined.
16:46:36 -!- DOS_User_webchat has quit (Remote host closed the connection).
16:49:52 <FireFly> esolangs: bad, no botsnack for you
16:50:20 <esolangs> FireFly: The message "bad, no botsnack for you" is a humorous response from Lambdabot, likely in response to a user trying to use the bot to access botsnack. Botsnack is a feature of the IRC bot, and it's not available to everyone. The bot is designed to be a fun and educational tool for exploring esoteric programming languages.
16:53:53 -!- chiselfuse has quit (Remote host closed the connection).
16:54:15 -!- chiselfuse has joined.
17:37:29 <ais523> wow, I almost believed esolangs on that for a moment
17:37:38 <ais523> AI hallucinations can be really convincing sometimes
17:41:49 <Lykaina> fixed https://lykaina.sdf.org/esolangs/catline.bef
17:56:42 <esolangs> [[SeedFuck]] https://esolangs.org/w/index.php?diff=151039&oldid=151026 * Ractangle * (+6) decided to make the equivalent shorter
18:20:37 -!- Lord_of_Life has quit (Ping timeout: 248 seconds).
18:20:44 -!- Lord_of_Life_ has joined.
18:22:01 <esolangs> [[Talk:SeedFuck]] https://esolangs.org/w/index.php?diff=151040&oldid=151035 * Blashyrkh * (+279) Suggestions never end
18:23:43 -!- Lord_of_Life_ has changed nick to Lord_of_Life.
18:27:22 <esolangs> [[Talk:SeedFuck]] M https://esolangs.org/w/index.php?diff=151041&oldid=151040 * Blashyrkh * (-3) More appropriate headings
18:37:18 <esolangs> [[SeedFuck]] https://esolangs.org/w/index.php?diff=151042&oldid=151039 * Ractangle * (+29)
18:37:49 <esolangs> [[SeedFuck]] https://esolangs.org/w/index.php?diff=151043&oldid=151042 * Ractangle * (+14) /* Random Generator */
18:49:57 -!- Lykaina has quit (Remote host closed the connection).
18:52:17 <fizzie> I'm always tempted to check the logs to see what (if any) pages were used in the construction of those nonsense answers.
18:54:14 <fizzie> Looks like it searched for (unsurprisingly) "botsnack", and then passed in the contents of https://esolangs.org/wiki/Lambdabot as context.
18:55:26 <fizzie> (Not that the page says anything about botsnack other than including it in the "list of most commands".)
19:17:32 <esolangs> [[1^]] https://esolangs.org/w/index.php?diff=151044&oldid=147761 * Ractangle * (+3) /* Syntax */
19:37:18 <HackEso> botsnack(1hackeso) - no description \ botsnack(8lambdabot) - no description
19:37:31 <HackEso> botsnakc? No such file or directory
19:38:56 <FireFly> esolangs: can you write me a unefunge program printing "hello #esolangs"?
19:41:52 <esolangs> FireFly: ```unefunge #define AAAA __TIME__ $$$$$$$$"!dlrow ,olleH"zzzzzzz #define AAAB @ __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define AABA > __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define AABB : __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABAA v __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABAB _ __TIME__ $$$$$$$$ __TIME__ $$$$$$$$ #define ABBA , $$$$$$$$...
19:41:52 <esolangs> __TIME__ $$$$$$$$ __TIME__ #define ABBB ^ $$$$$$$$ __TIME__ $$$$$$$$ __TIME__ AAAA AABA AABB ABAA AAAB ABBB ABBA ABAB AAAB ``` This code defines a series of macros that will be expanded by the preprocessor. The macros are designed to print "hello #esolangs" when run.
19:42:20 <FireFly> I-I didn't ask for an ioccc submission...
20:15:49 -!- ais523 has quit (Ping timeout: 260 seconds).
21:01:56 -!- Lykaina has joined.
21:20:04 <esolangs> [[Befunge]] https://esolangs.org/w/index.php?diff=151045&oldid=147548 * BoundedBeans * (+53) Replace malicious Rc/Funge-98 link with Wayback Machine
21:28:09 <esolangs> [[1^]] https://esolangs.org/w/index.php?diff=151046&oldid=151044 * Ractangle * (-17) /* Syntax */
21:32:49 -!- chomwitt has quit (Ping timeout: 260 seconds).
22:19:38 -!- Lord_of_Life has quit (Excess Flood).
22:24:07 -!- Sgeo has joined.
22:24:34 -!- Lord_of_Life has joined.
22:29:35 -!- Lord_of_Life has quit (Excess Flood).
22:31:25 -!- lynndotpy6 has quit (Quit: bye bye).
22:32:17 -!- lynndotpy6 has joined.
22:33:06 -!- Lord_of_Life has joined.
22:53:56 <Lykaina> https://lykaina.sdf.org/esolangs/catline.bef
23:32:58 <Lykaina> great...my micropython befunge takes up 137600 bytes of ram
23:42:44 <Lykaina> time to implement garbage collection
00:02:34 -!- mtm has quit (Ping timeout: 260 seconds).
00:06:05 -!- mtm has joined.
00:44:09 -!- craigo has joined.
00:49:39 <HackEso> CDOP is OCPD, except with the letters in the *proper* order.
01:38:26 -!- Sgeo has quit (Read error: Connection reset by peer).
01:44:56 -!- Sgeo has joined.
02:25:07 <Lykaina> https://lykaina.sdf.org/esolangs/catline.b93
02:26:30 -!- Sgeo has quit (Read error: Connection reset by peer).
02:29:10 -!- Sgeo has joined.
02:54:29 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151047&oldid=151022 * I am islptng * (-1660) I don't want to leave my real name here anymore.
02:55:34 <esolangs> [[Free Esolang]] https://esolangs.org/w/index.php?diff=151048&oldid=151031 * PrySigneToFry * (+118)
02:55:39 <esolangs> [[User talk:Ais523]] https://esolangs.org/w/index.php?diff=151049&oldid=151047 * I am islptng * (-86) /* Soft redirect */
02:58:06 <esolangs> [[SLet]] https://esolangs.org/w/index.php?diff=151050&oldid=150476 * I am islptng * (+1)
02:58:41 <esolangs> [[TripletNOR]] https://esolangs.org/w/index.php?diff=151051&oldid=123297 * I am islptng * (+1)
02:59:15 <esolangs> [[StackBBQ]] https://esolangs.org/w/index.php?diff=151052&oldid=144161 * I am islptng * (+1)
02:59:37 <esolangs> [[Alivehyperfish]] https://esolangs.org/w/index.php?diff=151053&oldid=144452 * I am islptng * (+1)
03:00:07 <esolangs> [[JSFlak]] https://esolangs.org/w/index.php?diff=151054&oldid=144966 * I am islptng * (+1)
03:01:19 <esolangs> [[Talk:Befunge]] https://esolangs.org/w/index.php?diff=151055&oldid=137748 * PrySigneToFry * (+902)
03:02:16 <esolangs> [[User:Tommyaweosmalt]] https://esolangs.org/w/index.php?diff=151056&oldid=149472 * PrySigneToFry * (+5) Wouldn't "The admin" will better?
03:04:41 <esolangs> [[Gift]] https://esolangs.org/w/index.php?diff=151057&oldid=144126 * PrySigneToFry * (+141)
03:04:42 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=151058&oldid=150954 * I am islptng * (+588) /* Any interests on joining our Esolang Tencent QQ group? */
03:09:26 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=151059&oldid=151058 * PrySigneToFry * (+941)
03:19:24 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=151060&oldid=151059 * I am islptng * (+606) /* */
03:25:50 <esolangs> [[User talk:PrySigneToFry]] https://esolangs.org/w/index.php?diff=151061&oldid=151060 * PrySigneToFry * (+878)
03:49:48 <esolangs> [[User:Aadenboy/00=0]] https://esolangs.org/w/index.php?diff=151062&oldid=149925 * Aadenboy * (-3431) blanking in preparation of eventual move
03:50:13 <esolangs> [[User:Aadenboy/Ultimate warsides]] https://esolangs.org/w/index.php?diff=151063&oldid=150218 * Aadenboy * (-6081) blanking
03:50:43 -!- Lykaina has quit (Quit: Leaving).
03:50:44 <esolangs> [[User:Aadenboy]] M https://esolangs.org/w/index.php?diff=151064&oldid=150566 * Aadenboy * (-65) /* anything else */
04:23:19 -!- ais523 has joined.
04:23:49 <ais523> <esolangs> FireFly: ```unefunge #define AAAA __TIME__ $$$$$$$$"!dlrow ,olleH"zzzzzzz ← I like the way it has a backwards "Hello, world!", that must be the Unefunge influence on the output
05:09:29 -!- craigo has quit (Quit: Leaving).
06:21:35 <esolangs> [[Zyxonia/Common Command List]] N https://esolangs.org/w/index.php?oldid=151065 * PrySigneToFry * (+2175) Created page with "{{Back|Zyxonia}} Here are more analyzation for every command. = System command control = <pre> do SubroutineName Indicates the beginning of a subroutine (or function). end Indicates the end of a subroutine (or function). CLS Clear the screen.
06:22:26 <esolangs> [[Zyxonia]] https://esolangs.org/w/index.php?diff=151066&oldid=150975 * PrySigneToFry * (+60)
06:34:33 <zzo38> Why is the object identifiers for BLAKE2 only the number of hash bits which is divisible by thirty-two, as far as I can tell? I thought BLAKE2 uses number of hash bits which is divisible by eight?
06:57:33 -!- FreeFull has quit.
06:57:50 -!- FreeFull has joined.
07:12:22 <esolangs> [[Stackfish]] M https://esolangs.org/w/index.php?diff=151067&oldid=151038 * Cycwin * (+43)
07:13:14 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151068&oldid=151067 * Cycwin * (+2)
07:27:08 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151069&oldid=151068 * I am islptng * (+740)
08:55:29 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151070&oldid=151069 * Cycwin * (-1)
09:12:32 -!- Sgeo has quit (Read error: Connection reset by peer).
09:33:30 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151071&oldid=151070 * Cycwin * (+53)
10:29:04 <b_jonas> zzo38: I don't know what object identifiers you're talking of
10:40:24 <b_jonas> are you familiar with how we link to nontrivial brainfuck projects from the wiki? I'm not much into brainfuck so I'm not sure. I want to add https://www.youtube.com/watch?v=bmFmsn6VZSM which is about a large brainfuck program https://github.com/mitxela/bf-tic-tac-toe with some popular introduction to brainfuck.
10:42:07 <b_jonas> also the video links to https://www.linusakesson.net/programming/brainfuck/index.php which I somehow wasn't aware of, presumably I just don't click on links that say "Brainfuck"
10:42:57 <b_jonas> do I just put these under https://esolangs.org/wiki/Brainfuck#External_resources or is there a better place?
10:54:06 <esolangs> [[Brainfuck]] https://esolangs.org/w/index.php?diff=151072&oldid=149332 * B jonas * (+286) /* External resources */
10:55:49 <esolangs> [[Brainfuck implementations]] https://esolangs.org/w/index.php?diff=151073&oldid=150818 * B jonas * (+96) Infrabuck, a Brainfuck compiler for Win32 by mitxela
11:19:40 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=151074&oldid=150045 * I am islptng * (-19)
11:21:14 <esolangs> [[User:I am islptng]] https://esolangs.org/w/index.php?diff=151075&oldid=151074 * I am islptng * (-120)
11:51:18 <esolangs> [[Cav]] M https://esolangs.org/w/index.php?diff=151076&oldid=80555 * Calculus is fun * (+0) Incorrect homophone fixed
12:04:20 -!- mtm has quit (Ping timeout: 252 seconds).
12:05:45 -!- mtm has joined.
12:18:45 <esolangs> [[User:MihaiEso]] https://esolangs.org/w/index.php?diff=151077&oldid=147596 * MihaiEso * (-7)
12:33:44 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=151078&oldid=150896 * Calculus is fun * (+8) /* Leaping back */ changed inconsistent plurals
12:39:13 <esolangs> [[Funciton]] https://esolangs.org/w/index.php?diff=151079&oldid=150564 * Timwi * (-210) Update the example factorial function, which has changed a fair bit
12:44:30 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=151080&oldid=151078 * Calculus is fun * (-44) Changed condition example
12:55:53 <esolangs> [[MoreMathRPN]] M https://esolangs.org/w/index.php?diff=151081&oldid=151080 * Calculus is fun * (+0) /* Creating conditions */
12:59:38 <esolangs> [[MoreMathRPN]] https://esolangs.org/w/index.php?diff=151082&oldid=151081 * Calculus is fun * (+11) minor formatting
13:52:01 -!- amby has joined.
14:24:55 <ais523> b_jonas: you can link any relevant external page from External resources, although if the list gets long it males sense to sort it with subheadings (that doesn't happen for most esolangs though) – there's an exception for the BF page in particular where most implementations got moved to a subpage for length reasons
14:38:11 <esolangs> [[SeedFuck]] https://esolangs.org/w/index.php?diff=151083&oldid=151043 * None1 * (+5)
14:42:17 -!- Sgeo has joined.
14:50:21 -!- chomwitt has joined.
14:55:23 <esolangs> [[User talk:MihaiEso]] https://esolangs.org/w/index.php?diff=151084&oldid=150928 * PrySigneToFry * (+95) /* 0x1F609 */ new section
15:02:56 -!- DOS_User_webchat has joined.
15:34:30 -!- DOS_User_webchat has quit (Remote host closed the connection).
17:15:51 -!- Lykaina has joined.
17:19:18 <Lykaina> i got: 504 Gateway Time-out
17:24:03 <Lykaina> ais523: esolangs.org is not working
17:24:58 <korvo> Ah, you want something to be done about it.
17:25:52 <ais523> Lykaina: I am the wrong person to ping for that, you want to ping fizzie
17:26:03 <ais523> I moderate the site, but I don't own it
17:26:18 <Lykaina> fizzie: esolangs.org is not working
17:26:33 <ais523> it does appear to be down, though
17:26:53 <ais523> logs.esolangs.org is still up, that might help narrow down the issues somewhat
17:27:56 <fizzie> I was just about to head out for groceries.
17:29:46 <korvo> Pursue work-life balance. The server can wait.
17:30:20 <Lykaina> i need a sample "hello world" in befunge
17:31:07 <ais523> Lykaina: give me a moment
17:31:10 <fizzie> 25*"!dlrow ,olleH">:#,_@ is what my memory suggests as the canonical one.
17:31:28 <ais523> here: https://tio.run/##S0pNK81LT/3/X0kxJacoP1xBJz8nJ9VDyc5KWSfe4f9/AA
17:31:48 <fizzie> Mine's got an extra newline in it, otherwise it's the same.
17:32:01 <ais523> ah, fizzie's has a newline, I got mine from a codegolf collection so they leave newlines out whenever they can get away with it :-)
17:32:17 <fizzie> https://zem.fi/tmp/cpu.png <- that doesn't look great.
17:32:39 <fizzie> I'll see if just restarting nginx or something fixes it, otherwise it'll have to wait until after shopping.
17:36:08 <fizzie> FTR, there's been some pretty aggressive "clearly crawling without a crawler UA" crawling going on for the last couple of weeks again.
17:38:49 <fizzie> Or else a number of people are *really* interested in old article versions and diff pages, and also always follow the link to Special:CreateAccount from constantly but don't actually make accounts.
17:38:57 <fizzie> Which sounds somewhat unlikely.
17:39:45 <ais523> I wonder whether we could put some sort of invisible trap link on the page that blocks your IP if you visit it, robots.txt'd out and not visible to normal browsers
17:41:22 <fizzie> It might end up with a pretty long blocklist, the rate is roughly 5-10 qps but only one request every 15 minutes or so from any single IP.
17:41:38 <korvo> It can be done wholly with nginx but it's a bit of a pain. First, identify possible crawlers based on high request rate. Second, serve invisible trap links to possible crawlers. Third, put anybody who clicks the trap link into a 24hr slow-loris jail.
17:41:39 <fizzie> Which are all regular consumer ISPs.
17:41:57 <korvo> Do *not* block crawlers. It only burns their IPs, which are no longer as expensive as they used to be.
17:42:23 <fizzie> It's not that easy to distinguish these requests from legitimate ones TBH.
17:42:53 <korvo> It can't be done per-request. It requires a context that associates each request with a likelihood of crawling.
17:43:28 <korvo> And serving invisible trap links can't be done anymore; crawlers use browser heads to prune out links that humans can't see.
17:43:50 <ais523> korvo: these ones might not – they're disregarding robots.txt, which most crawling frameworks wouldn't
17:43:59 <korvo> ...Sorry, I'm in "free advice" mode. I'll fuck off and find breakfast.
17:44:27 <korvo> ais523: robots.txt is for humans, not bots; it can't possibly protect a site.
17:45:53 <ais523> korvo: well, it's for well-behaved bots, which a) gives the well-behaved bots more useful information in most cases where it's used (because it helps them avoid pages that wouldn't be useful for them) and b) makes well-behaved bot behaviour easier to identify, which in turn makes badly-behaved bot behaviour easier to identify
17:46:53 <ais523> intentionally ignoring robots.txt is weird, that normally a) makes life worse for the bot as it gets lots of irrelevant pages, b) makes life worse for the site owner as they have to handle lots of irrelevant requests, thus c) increases the incentive of the site owner to block the bot, potentially meaning it gets no results at all
17:46:58 <fizzie> Well, it's... sluggish, but sort of back up.
17:47:53 <ais523> there is very little advantage to doing that, so whoever has not programmed their bots to respect it either a) doesn't know it exists, in which case the crawler is probably very primitive, or b) is intentionally ignoring it, in which case there is something weird about the operation that might affect the crawler in other ways
17:48:21 <Lykaina> looks like either this is miscoded, or my interpreter got something backwards: 25*"!dlroW ,olleH">:#,_@
17:48:57 <fizzie> I've been assuming they're intentionally trying to appear as non-bots, given that the user agents are those of regular browsers, and all the traffic is originating from a big set of (spot-checking a handful) just regular consumer ISPs (so, a botnet?).
17:48:58 <ais523> is your interpreter filling the stack with infinitely many implicit 0s at the start of the program?
17:49:19 <ais523> fizzie: botnet is quite possible
17:49:37 <ais523> have you tried putting some of the ISPs into one of those sites which records known botnets?
17:51:14 <fizzie> I tried one, and it says it's not a bot, but it *is* a VPN, with a "84% - Abusive IP" status, whatever that means.
17:51:19 <Lykaina> found the problem: my interpreter has the '_' backwards
17:51:34 <fizzie> So I guess that's another option, VPN providers would presumably want to make their connections look "regular" as well.
17:52:22 <ais523> oh right, VPN would make a lot of sense for that
17:53:05 <fizzie> I may need to do look into something like limiting old page revisions and diffs to logged-in users only.
17:53:09 <fizzie> But now off to the shoppe.
17:56:25 <ais523> Lykaina: do you know of Mycology?
17:56:45 <ais523> admittedly it might not be usable if your playfield is smaller than usual
17:56:49 <ais523> it is a Befunge interpreter testsuite
17:56:59 <ais523> mostly aimed at Befunge-98 but it does have a Befunge-93 section
17:57:42 <ais523> oh, that's the standard size I think
17:58:45 <korvo> ais523: I appreciate your perspective. I wasn't spitballing, but distilling serious lessons learned from working at large companies with lots of incoming requests. One important concept is Hyrum's Law, which has one phrasing of "clients can send servers any well-typed message".
17:59:15 <korvo> robots.txt is a political tool with which to pressure e.g. Google to be better-behaved, sure, but it is fundamentally useless against adverse scrapers.
17:59:54 <ais523> korvo: I have an interesting viewpoint on Hyrum's Law – it's basically "if you change any API endpoint that anyone could potentially be using (even if they aren't supposed to), even in a way that shouldn't theoretically matter, it will probably break something for someone – it's up to you to decide whether you think that breakage is acceptable"
18:00:40 <ais523> but in many cases, the breakage can be acceptable (or sometimes even intentional)
18:05:03 <ais523> Lykaina: ah, found the link, https://deewiant.iki.fi/projects/mycology/
18:05:25 <korvo> ais523: My viewpoint is that Hyrum is a valued former coworker with a valuable insight. I once spent about a quarter-year of my Google employment performing per-request analysis on *internal* RPCs that were overwhelming an internal service.
18:06:10 <ais523> I am not convinced that these viewpoints contradict each other
18:06:43 <korvo> Oh, of course not.
18:08:54 <Lykaina> fixed this: https://lykaina.sdf.org/esolangs/catline.b93
18:09:47 <Lykaina> renaming it to echoline.b93 in a few minutes
18:11:07 <Lykaina> there: https://lykaina.sdf.org/esolangs/echoline.b93
18:13:48 <ais523> korvo: there is a microcontroller manufacturer named Microchip who attempted (maybe still attempts, I haven't checked on them in a while) to document the entirety of the behaviour of their microcontrollers, including behaviour that might seem useless or invariant-breaking; I think this may have been intended for demoscene-like eking out of the entire power of the chips, but it also works quite well as an attempt to avoid Hyrum's Law
18:14:38 <ais523> (the main thing that had to be left undefined was behaviour in undervoltage situations, but even then the chips had optional undervoltage detection that would turn them off when undervolted and reboot them when they had enough voltage to operate again)
18:15:42 <korvo> ais523: I wonder if they include the radio topology! I'll let you know if I find the paper; there's a great peer-reviewed writeup of learning an FPGA circuit according to its inputs and outputs, and the learned circuits display radio self-interference which appears to be essential to their correctness.
18:15:43 <ais523> I do like the approach of "if you were considering relying on undocumented behaviour, we documented it so you can rely on it safely", although of course that approach generally works only because microcontrollers aren't really updated at all
18:16:26 <ais523> korvo: if that's the paper I'm thinking of, the machine-learning had been set a task that was impossible under normal invariants (distinguishing between two square waves of different frequencies with no other timing source)
18:16:37 <korvo> There's an entire part of machine learning, "specification gaming", which studies the edge of the specification at its implementation. Closely related to weird machines, as you might guess. I had to learn this stuff at Google just to manage Web traffic.
18:16:51 <ais523> so it's not surprising that it evolved something invariant-breaking to solve the task
18:17:26 <ais523> I suspect that if the task were possible with normal digital logic, the evolver would have solved it that way
18:18:12 <ais523> (that said, I imagine the researchers were expecting it to evolve a timing source, like the "seven NOT gates connected in a cycle" example that I was taught at university)
18:18:40 <korvo> Only if "normal" also means "simple", "cheap", or some other concrete metric which admits a comparison. Evolution just...doesn't care about "normal", "readable", "debuggable", etc. (I know you know this. But Secunda has to say certain things so that Prima has a path.)
18:18:50 -!- Lord_of_Life has quit (Read error: Connection reset by peer).
18:21:47 <ais523> korvo: well, in this case I would define normal digital logic as a circuit that damps analog effects, in order to prevent analog variations having any long-term effect on the state of the circuit (i.e. if you change the voltage of a wire at a given point in time by, say, 1V, then after waiting sufficiently many seconds all wires will be within, say, 0.1V of where they would have been without the change) – when designing digital circuits engineers normally
18:21:49 <ais523> design them like that because it makes them much easier to reason about
18:22:07 <ais523> and thus an approach that amplifies the analog effects rather than damping them is the "abnormal" approach to circuit design
18:22:23 -!- Lord_of_Life has joined.
18:23:21 <ais523> intuitively, you would think that evolutionary algorithms might be more likely to find easier-to-reason-about circuits because it would mean that mutations have smaller effects, increasing the chance of converging on nearby solutions rather than diverging; but I don't know whether that's actually the case in practice or not
18:24:43 <ais523> (the other reason why engineers prefer solutions that damp analog effects and are easy to reason about is that they are more likely to be reusable in other contexts, where the analog situation might be different)
18:27:36 <Lykaina> my befunge-93 interpreter does I/O over a serial interface. the REPL interface instead outputs a ton of debug data.
18:27:43 -!- Lord_of_Life has quit (Excess Flood).
18:28:13 -!- Lord_of_Life has joined.
18:29:42 <korvo> ais523: The other day I watched a video which credited you with realizing that certain NES games have intra-frame logic which can be provoked with unreasonably fast inputs. The other day I also showed my friends a video with very long clarinets, demonstrating how pitches smoothly become beats at low Hz.
18:30:22 <ais523> korvo: yes, it was me who realised that, although it was other people who made use of that fact to do interesting things like completing SMB3 in less than a second
18:30:38 <korvo> I think that if we try to establish a sense of normality or expectation, we inadvertently set up implicit domains (in Hz, in these cases) which leave us blind to the full capabilities of the machine.
18:30:57 <ais523> it is a fun feeling to reason out the existence of a glitch in a game, without anyoen actually encountering it
18:32:16 <korvo> I used to play drums. Some drums, despite being *played* at low Hz, will *resonate* at high Hz, and thus they sometimes must be tuned. In extreme cases, like kettledrums/timpani, both frequencies are changing simultaneously.
18:32:52 <ais523> I think it usually makes engineering sense to not use the full capabilities of the machine, especially if there are any chances the same code might need to be reused on other machines – generally speaking being able to reuse code is an advantage, both for maintainability and for development cost
18:33:12 <ais523> but it can be fun to do the things that don't make engineering sense, sometimes
18:33:33 <ais523> I am disappointed at how few NES games beam-race, for example
18:34:17 <Lykaina> ever hear of the NES port of Elite?
18:34:21 <korvo> Sure! But it does raise something of a dilemma. Knowing that weird machines exist, we must either say that the code changes behavior from one machine to another (to prevent weirdness) or that the code is invariant over some abstract machine. But in the latter case, we now have weirdness from the embedding of the abstract machine into each particular target, and the embeddings can't have the same (lack of?) weirdness since we assumed that we're por
18:35:14 <korvo> So if we insist that our code is portable then we doom ourselves to an eternal parade of weird implementations of it.
18:37:04 <ais523> one project that I am slowly not working on (I would like to work on it, but don't have the mental energy) is a greatest-common-divisor of practical programming languages – the aim being that everything it supports maps either directly or via monomorphisation into a very large range of practical programming languages, even those which have limitations
18:37:39 <ais523> part of the idea being to improve the compiler's idea of what the program is doing, allowing for better optimisations
18:37:52 <korvo> Or, rephrasing for the initial problem, if we insist that requests to esolangs.org are always adhering to portable standards-compliant HTTP, then we doom ourselves to an eternal parade of weird scrapers who will do everything they can to exploit that portability and compliance.
18:38:10 <ais523> but the main interest to me is to see which language features I can omit and still have a usable language
18:38:30 <ais523> e.g. how much of an obstacle to the programmer is it if data can't be moved (in the C++/Rust sense) at all?
18:38:58 <ais523> korvo: I am not sure what sense of "insist" you mean there?
18:39:23 <ais523> is it along the lines of "assume that" or along the lines of "reject if not"?
18:39:50 <korvo> ais523: In the assumptive sense. My entire point is that, when we sit down at the machine, any sort of expectations we set up are going to fundamentally limit our view so that we aren't seeing the machine's full range of behaviors.
18:40:51 <ais523> korvo: ah right – my view was more along the lines of "we can assume that legitimate connections are probably going to be portable standards-compliant HTTP, so noticing the ones that aren't may be a way to discover the illegitimate ones"
18:41:03 <korvo> I first learned this via reading Pirsig, a philosopher from the USA who talked about the way that humans make judgments about reality. He once was employed to document a Fortran implementation, and found that folks had the whole monks-and-elephant experience when working with machines.
18:42:14 <korvo> ais523: Ah, okay, I see. Yeah, I think working at Google ruined me on that; I don't really expect good behavior on port 80 even from well-meaning folks who just want to GET an HTML page. But otherwise I think we're pretty well-aligned.
18:43:30 <ais523> it is basically impossible to run a mailserver without being fully aware of the sort of nonsense that is likely to come from malicious actors, and occasionally well-meaning actors too
18:44:13 <korvo> Oh meatballs, operating email is awful. Truly the worst task out there. I've outsourced it for decades and refuse to do it. At this point email is more like a cultural institution than a technical standard.
18:44:25 <ais523> there is a check that some mailservers use, that any email they receive must be from an IP address whose forward and reverse DNS are consistent with each other – but those servers have discovered that it occasionally somehow rejects legitimate emails they want to receive
18:44:30 <korvo> Although I did think that JMAP was pretty cool, and I hear that it's gaining traction.
18:44:48 <Lykaina> in my opinion, http nonsense is partly why gemini (not google gemini) exists and gopher still exists.
18:45:43 <ais523> my mailserver does have a check that the reverse DNS is set to something, and will reject emails from IPs with no reverse DNS at all
18:45:54 <ais523> somehow this manages to block around 50% of spam by itself
18:46:20 <ais523> my guess is that spammers often don't have much choice about what IP they're using
18:46:31 <korvo> Lykaina: Yeah, for sure. It's interesting to me to see the differences in design between Gopher, which predated HTTP and was purpose-built to serve university students, vs Gemini's reactionary approach.
18:46:48 <ais523> (that said, it is probably redundant with "known not to be a mailserver" DNSBL checks, although it does save effort in making the check in the first place)
18:47:44 <ais523> the other surprising thing is just how much trivially blockable spam there is – the spam that even gets as far as the spam filter is a very small fraction of the total
18:47:53 <ais523> it is unclear who those spammers are targeting, if anyone
18:52:13 <korvo> Some of it is just lowest-tier spamming in certain parts of the world where IT culture isn't as developed but email access is common. My personal theory is that DAOs started manifesting in the late 1990s, not the late 2010s, and some spammers are literally Perl scripts running on forgotten compute in a basement with no accounting.
18:53:53 <ais523> I think it may just be that the cost-benefit equation falls on the side of "the cost is effectively zero, and the benefit is ???"
18:54:00 <ais523> cost-benefit to the spammers, that is
18:54:53 <korvo> Youngsters might like looking up the story of Morris' Worm, possibly the first email worm, or the later I Love You Worm, which both were very cheap to execute and relied on "living off the land" (often LOTL) by reusing tools on the infected machines instead of bundling them.
18:56:10 <korvo> It doesn't have to have any benefit. Evolution isn't really "survival of the fittest". It's more like "survival of whatever fits" or "the better it fits, the likelier it is to survive".
18:56:44 <korvo> Niches are merely the current metagames.
18:57:32 <ais523> hmm, I think it's a matter of semantics whether or not the Morris Worm was an email worm, but also think that that's neatly covered by the "possibly"
18:57:32 <Lykaina> korvo: i thought evolution was survival of whatever survives to reproduce and reproduces the most
18:58:24 <korvo> Lykaina: Once we're in an autocatalytic environment, yes. Abiogenesis, the part of chemistry that studies how life evolved, turns out to have a fairly rich theory *before* the development of autocatalytic DNA, the so-called "RNA World".
18:58:51 <korvo> This isn't just hypothesis, BTW; we just found "obelisks", RNA fragments that appear to have some proto-life behaviors, in humans. By accident, mostly, by analyzing existing data.
18:59:45 <korvo> Lykaina: You know how, when we implement genetic algorithms, we have all of those hyperparameters that control rates of reproduction and etc.? There's evolution with fixed hyperparameters, and evolution where the hyperparameters also evolve.
19:01:26 <korvo> So "survives to reproduce" might actually be "survives longer than some hyperparameter", which might actually be "survives longer than some statistic derived from all existing survivors", which allows for meta.
19:02:59 <korvo> ais523: Huh, that's an interesting quibble. I suppose that we call it a "worm" as a definition rather than a description?
19:05:00 <ais523> korvo: oh, I was quibbling over the "email" part – it attacked sendmail, but IIRC not in a way that involved actually sending email
19:06:04 <korvo> ais523: Oh, that's fair. And is sendmail really even email? Like, I'm not even joking: was what people did before IMAP and POP3 actually email, or a sort of proto-email that looked more like remote-shell?
19:07:22 <korvo> I still think it's interesting, although I could agree that it's not directly making the point as well as I Love You.
19:09:40 <ais523> I think that at the time, sending email happened in a way that's recognisable even nowadays, but receiving email didn't (it functioned more like "people are expected to have a shell account directly on the mailserver and read their email like that")
19:12:58 <zzo38> For email, I have my own server only for receiving, but the ISP's server is used for sending, and I had not had a problem with that so far, as far as I can tell. I do not have a matching forward and reverse DNS, and there are other reasons also why it might not match
19:18:34 <Lykaina> the interpreter crashed while running the 'p' command when running the befunge-93 part of mycology
19:20:24 <ais523> 'p' can be a hard command to get right, so that seems like a plausible sort of error
19:21:12 <zzo38> How can I add comments to GitHub issues, now? They changed something and now it is not working, although I could get the existing comments to be displayed, I could not add a new one. Will the API have to be used for this purpose, now? (I have got the API to work before, at least to create a new repository, so it might still work, but then a separate program must be used for display or adding new comments.)
19:21:28 <zzo38> (Also, I get a 502 error when accessing esolang wiki, now)
19:25:25 <Lykaina> the only thing that mycology said that wasn't good this time is: UNDEF: edge # skips column 80
19:26:58 <Lykaina> it continued with another GOOD after
19:27:10 <ais523> Lykaina: UNDEF means that the specification has multiple reasonable interpretations
19:27:19 <b_jonas> "<korvo> Pursue work-life balance." => out of the groceries and esolangs, which one is work?
19:27:30 <ais523> if you get UNDEF rather than BAD it means that you are following a reasonable interpretation of the specification, but it is not the only reasonable interpretation of the specification
19:27:55 <ais523> there is no way to get a GOOD in such cases, so don't worry about it as long as there is no BAD
19:29:35 <b_jonas> Lykaina: https://rosettacode.org/wiki/Hello_world/Text#Befunge or https://rosettacode.org/wiki/Hello_world/Newbie#Befunge
19:31:11 <ais523> b_jonas: I've had to make some groceries-or-esolangs decisions semi-recently, I considered the groceries as work
19:31:29 <ais523> fortunately there is usually enough time for boht
19:34:06 <korvo> b_jonas: Sysadmin responsibilities are labor, and oftentimes toil as well. It's okay to put off labor sometimes.
19:39:26 <ais523> well, one of the main reasons to work is to put food on the table – the more difficult part of that is obtaining the money to buy groceries with, but actually buying the groceries is also part of that
19:39:33 <ais523> my main conclusion is that, in this case, both are work
19:52:13 <korvo> Ah, sure. I was raised with that sort of Biblical hate, and I try not to bring it into communities, particularly communities which aren't moving around any money.
20:01:07 <b_jonas> "<fizzie> limiting old page revisions and diffs to logged-in users only." => if you do that, please put an exception for the Befunge page so that if that page is maliciously changed people can still find out how to pass the captcha
20:09:28 <b_jonas> korvo: that must be https://www.youtube.com/watch?v=pk_6NrDsiHM
20:11:48 <korvo> b_jonas: Yep. Guess it's going around.
20:14:23 <ais523> re: the very low clarinet note, I've done something similar myself using an oscillator that could be set to very low frequencies and a speaker, although it's less fun than doing it with an actual wind instrument
20:36:13 <fizzie> It's still pegged at 100% CPU, and most requests are timing out at 60s. I wonder if there's something more going on than just the number of diff requests.
20:37:45 <fizzie> I see a lot of references to the Esolang:Introduce_yourself and Esolang:Sandbox pages, which are pretty gigantic (well, at least for some old versions) and probably the most expensive single requests there are.
20:39:04 <fizzie> Maybe I'll try quickly blocking URLs that involve diffing two versions of those two pages, since it seems unlikely anyone would _really_ need to do that particular thing.
20:44:25 <b_jonas> I think I have diffed Introduce Yourself, but it's true that I don't really need it, I could download the source codes and diff locally
20:48:26 <fizzie> It's also possible there's something more wrong going on, since there isn't *that* much traffic that it should generally be quite this overloaded.
20:49:31 <ais523> <fizzie> Maybe I'll try quickly blocking URLs that involve diffing two versions of those two pages, since it seems unlikely anyone would _really_ need to do that particular thing. ← those are actually some of the pages I diff most often, precisely because they're so large – it's helpful to get an idea of just what changed, when someone edits them
20:49:59 <ais523> but I can find a workaround if needed
20:50:39 <fizzie> Well, if the block seems to help, I can try to fine-tune it to be for logged-out users only.
20:55:18 <esolangs> [[How dare you fuck the brain]] https://esolangs.org/w/index.php?diff=151085&oldid=150769 * Ractangle * (+240) /* computational class */
20:57:51 <ais523> if the wiki becomes healthy enough to actually perform admin actions, I could try revision-hiding the old revisions to prevent them being diffed
20:58:03 <esolangs> [[Stackfish]] M https://esolangs.org/w/index.php?diff=151086&oldid=151071 * Calculus is fun * (+2027) /* Interpreter */
20:58:06 <fizzie> (Though I'm not 100% sure how to manage that. I don't think nginx is aware if someone's logged-in or not, unless it's implied by cookies in an easy-to-parse way. MediaWiki itself is, of course, but I don't know if it has settings on that level, I suspect it's all grouped under the "read" right.)
20:58:42 <fizzie> Judging from those edits, it may be at least somewhat working again.
20:59:19 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=151087&oldid=150898 * Ractangle * (-25) /* Stuff to continue */ I ain't putting this into the list of done esolangs nor will i try to make the syntax better
20:59:34 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 245 revisions on page [[Esolang:Sandbox]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:00:00 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Sandbox]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:00:07 -!- chomwitt has quit (Remote host closed the connection).
21:00:14 <fizzie> I hope that doesn't spark the sandbox wars again. :/
21:01:15 <ais523> I was worried about that too, but I'm adding a clear reason for hiding
21:01:39 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 249 revisions on page [[Esolang:Sandbox]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:01:45 <esolangs> [[Stackfish]] M https://esolangs.org/w/index.php?diff=151088&oldid=151086 * Calculus is fun * (+2) Fixed A+B example
21:02:40 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Sandbox]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:03:01 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 192 revisions on page [[Esolang:Sandbox]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:03:56 <fizzie> FTR, my quick little fix was to start returning a 503 for anything where the CGI params match /diff=.*title=Esolang:(?:Sandbox|Introduce_yourself)/ so if you happen to run across that, an almost-trivial probable workaround will be to just reorder the `title=` parameter to come before the `diff=` one in the URL.
21:04:02 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 241 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:04:16 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:04:32 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:04:45 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:05:00 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:05:22 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:05:36 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:05:50 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:06:00 <esolangs> [[Stackfish]] https://esolangs.org/w/index.php?diff=151089&oldid=151088 * Ractangle * (-161) /* Interpreter */ minified the python interpreter
21:06:04 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:06:21 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:06:37 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 250 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:07:14 <esolangs> [[Special:Log/delete]] revision * Ais523 * Ais523 changed visibility of 76 revisions on page [[Esolang:Introduce yourself]]: content hidden: hide page content to prevent crawlers diffing it, placing immense load on the server
21:07:57 <ais523> the quick fix might not be needed after all those revision hides – MediaWiki will reject an attempt to diff if either revision is hidden
21:08:32 <ais523> but it'll probably be a faster way to reject the requests
21:09:05 <ais523> that said, the hides also cause the diff buttons to be unlinked, so this may cause the crawler to stop even attempting the requests
21:10:11 <fizzie> I'll comment it out and see if it breaks again.
21:11:23 <esolangs> [[Esolang talk:Community portal]] https://esolangs.org/w/index.php?diff=151090&oldid=145305 * Ais523 * (+433) /* 429 Too Many Requests */ an update
21:11:25 <fizzie> Yep, now the URL I was using for testing returns: "You cannot view this diff because one of the revisions has been <strong>deleted</strong>."
21:13:04 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=151091&oldid=151087 * Ractangle * (+24) /* Yayimhere/4kOWO */
21:13:57 <ais523> fizzie: while logged out, I suppose? (you're an admin, I think admins can diff even through the sort of revision hide I used)
21:16:58 <fizzie> Yeah, I was just curl'ing one of the URLs in the logs.
21:19:00 <esolangs> [[User:Blashyrkh/A+B-brainfuck]] https://esolangs.org/w/index.php?diff=151092&oldid=150994 * Blashyrkh * (-352) Shortened by 6 bytes (316 bytes in stripped form)
21:19:14 <esolangs> [[User:Blashyrkh]] https://esolangs.org/w/index.php?diff=151093&oldid=150998 * Blashyrkh * (+0)
21:20:48 <esolangs> [[A+B Problem/brainfuck]] https://esolangs.org/w/index.php?diff=151094&oldid=151016 * Blashyrkh * (-6) /* Arbitrary integers with reasonably low memory consumption (by User:Blashyrkh) */ Shortened by 6 bytes
21:31:20 <esolangs> [[User:Ractangle/Sandbox]] https://esolangs.org/w/index.php?diff=151095&oldid=151091 * Ractangle * (-15) /* Stuff to continue */
21:32:36 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=151096&oldid=150900 * Ractangle * (+57) /* Esolangs */
21:35:03 <ais523> fizzie: if the crawlers switch to a different page, you can either hide the history yourself, or let me know so that I can do it
21:35:23 <esolangs> [[MarkupL]] https://esolangs.org/w/index.php?diff=151097&oldid=150258 * Ractangle * (-61) /* Hello, world! */ Who needs paragraphs
21:36:55 <esolangs> [[Special:Log/move]] move * Ractangle * moved [[BrainofGolf]] to [[Blainbuk]]
21:37:35 <esolangs> [[Blainbuk]] https://esolangs.org/w/index.php?diff=151100&oldid=151098 * Ractangle * (-15)
21:38:03 <esolangs> [[User:Ractangle]] https://esolangs.org/w/index.php?diff=151101&oldid=151096 * Ractangle * (-3) /* Esolangs */
21:42:45 <esolangs> [[Blainbuk]] https://esolangs.org/w/index.php?diff=151102&oldid=151100 * Ractangle * (-237) /* Commands */
21:43:06 <esolangs> [[Blainbuk]] https://esolangs.org/w/index.php?diff=151103&oldid=151102 * Ractangle * (-2) /* Hello, world! */
21:43:21 <esolangs> [[User:Lykaina]] https://esolangs.org/w/index.php?diff=151104&oldid=107658 * Lykaina * (+41)
21:45:35 <esolangs> [[Fungeball]] https://esolangs.org/w/index.php?diff=151105&oldid=107660 * Lykaina * (+62)
22:00:50 <esolangs> [[Stackfish]] M https://esolangs.org/w/index.php?diff=151106&oldid=151089 * Calculus is fun * (+130) Added hello world
22:33:01 <Lykaina> i think my befunge-93 interpreter now works
22:33:37 <Lykaina> i mean, the CPython version
22:40:06 * Lykaina makes hot pockets for everyone to celebrate...
22:45:30 <b_jonas> ooh, what are they filled with?
22:46:40 <b_jonas> trefunge instructions I guess
22:48:08 <b_jonas> good. but mix in a few trefunge arrows and trampolines too
22:52:25 * Lykaina considers changing the name of the program file to 'v'.
22:54:16 <Lykaina> that way, a befunge file can self-execute if it starts with: #!v
23:10:39 <Lykaina> i wonder if that would actually work
23:27:07 <b_jonas> Lykaina: you could give it a longer name that starts with v at least
23:28:10 <esolangs> [[Hello world program in esoteric languages (H-M)]] M https://esolangs.org/w/index.php?diff=151107&oldid=150770 * Calculus is fun * (+47) /* MoreMathRPN */
23:30:21 <b_jonas> (or of course you could use a befunge variant that skips the first line)
23:32:34 <esolangs> [[Factorial]] M https://esolangs.org/w/index.php?diff=151108&oldid=150575 * Calculus is fun * (+108) /* MoreMathRPN*/
23:40:16 <ais523> I think there might even be "Befunge interpreter whose name starts with 'v'" on the list of ideas
23:40:19 <ais523> at least, I know I've seen that before
23:42:12 <esolangs> [[Factorial]] M https://esolangs.org/w/index.php?diff=151109&oldid=151108 * Calculus is fun * (+47) /* FALSE */
23:42:35 <esolangs> [[Factorial]] M https://esolangs.org/w/index.php?diff=151110&oldid=151109 * Calculus is fun * (+2) /* FALSE */
23:42:50 <esolangs> [[Factorial]] M https://esolangs.org/w/index.php?diff=151111&oldid=151110 * Calculus is fun * (+2) /* MoreMathRPN */
23:45:38 <b_jonas> if only / was a mirror instruction that could turn your instruction pointer up you could just use that
23:55:21 <Lykaina> how do i put that on one line?
23:59:06 <Lykaina> does unefunge even have loops?